SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012309 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012309
Domain Number 1 Region: 536-600,638-736
Classification Level Classification E-value
Superfamily PH domain-like 7.4e-30
Family Pleckstrin-homology domain (PH domain) 0.0092
Further Details:      
 
Domain Number 2 Region: 1094-1227
Classification Level Classification E-value
Superfamily Second domain of FERM 4.32e-19
Family Second domain of FERM 0.0046
Further Details:      
 
Domain Number 3 Region: 743-787
Classification Level Classification E-value
Superfamily PH domain-like 0.000000228
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000012309
Domain Number - Region: 996-1075
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000209
Family First domain of FERM 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012309   Gene: ENSGGOG00000012607   Transcript: ENSGGOT00000012666
Sequence length 1371
Comment pep:known_by_projection chromosome:gorGor3.1:2a:44397349:44468753:1 gene:ENSGGOG00000012607 transcript:ENSGGOT00000012666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQVMEDKLKAANIQTSESETRLYNKCQDLESLIQEKDDIIQNLELQLEEQKQIRIQEAKI
IEEKAAKIKEWVTVKLNELELENQNLRLINQNQTEEIRTMQSKLQEVQGKKSSTVSTLKL
SEGQRLSSLTFGCFLSRARSPPQVVKSEEMSKISSKELEFTEGKDMEEMEIPEKSVDNQV
LENNRGQRTLHQTPCGSEQNRKTRTSFATDGGISQNSGAPVSDWSSDEEDGSKGRSKSRC
TSTLSSHTSEEGVQCSRMGSEMYLTASDDSSSIFEEETFGIKRPEHKKLYSWQQEAQWKA
LNSPLGKGNSELSKKEQDSSSDELNKKFQSQRLDYSSSSSEANTPSPILTPALMPKHPNS
LSGKGTQLVPSSHLPPPKLRIPNVFSVSVALAKKHLSQPQLSSDRMFGTNRNAISMIRPL
RPQETDLDLVDGDSTEVLENMDTSCDDGLFSYDSLDSPNSDDQENCDSAKKVACSKPPTP
PLHRFPSWESRIYAVAKSGIRMSEAFNMESVNKNSVATLSYTTSGLYTSLIYKNMTTPVY
TTLKGKATQISSSPFLDDSSGSEEEDSSRFSSRTSESDSRSRSGPGSPRAMKRGVSLSSV
ASESDYAIPPDAYSTDTEYSQPEQKLPKTCSSSSDNGKNEPLEKSGYLLKMSGKVKSWKR
RWFVLKGGELLYYKSPSDVIRKPQGHIELSASCSILRGDNKQTVQLTTEKHTYYLTADSP
NILEEWIKVLQNVLRVQAANPLSLQPEGKPTMKGLLTKVKHGYSKRVWCTLIGKTLYYFR
SQEDKDTWLYHLTVAAGSNNVNVGSEFEQLVCKLLNIDGEPSSQIWRHPTLCHSKEGIIS
PLTTLPSEALQTEAIKLFKTCQLFINAAVDSPAIDYHISLAQSALQICLTHPELQNEICC
QLIKQTRRRQPQNQPGPLQGWQLLALCVGLFLPHHPFLWLLRLHLKRNADSRTEFGKYAI
YCQRCVERTQQNGDREARPSRMEILSTLLRNPYHHSLPFSIPVHFMNGIYQVVGFDASTT
VEEFLNTLNQDTGMRKPAQSGFALFTDDPSGRDLEHCLQGNIKICDIISKWEQASKEQQP
GKCEGTRTVRLTYKNRLYFSVQARGETDREKLLLMYQTNDQIINGLFPLNKDLALEMAAL
LSQVEIGDFERPFSTPAGHVTNQCKVNQTLKQVIEKFYPKRYRDGCSEEQLRQLCQRLST
RWMALRGHSAADCVRIYLTVARKWPFFGAKLFLAKPITPSSLGSTFLWLAVHEDGLSLLE
YNSMRLIVSYVYKSLMTFGGCQDDFMVVINNTHSKDKPTEKLLFAMAKPKILEITLLIAS
YINNFHQQKAAFHHLSAPALLSAQTRGPQARMMGSQPLLSSSRPTKGPTLL
Download sequence
Identical sequences ENSGGOP00000012309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]