SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012317 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012317
Domain Number 1 Region: 50-226
Classification Level Classification E-value
Superfamily PR-1-like 1.1e-53
Family PR-1-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012317   Gene: ENSGGOG00000012634   Transcript: ENSGGOT00000012674
Sequence length 258
Comment pep:known_by_projection chromosome:gorGor3.1:8:73253713:73287429:1 gene:ENSGGOG00000012634 transcript:ENSGGOT00000012674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIAISAVSSALLFSLLCEASTVVLLNSTDSSPPTNNFTDIEAALKAQLDSADIPKARRKR
YISQNDMIAILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHGPSYLLRF
LGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWAT
SNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCPPSYGGSC
TDNLCFPGVTSNYLYWFK
Download sequence
Identical sequences A0A2I2Z403 A0A2K5IK76 A0A2K6M6L5 A0A2K6P3Z3 H2QWB2 O43692
9598.ENSPTRP00000034834 9606.ENSP00000260113 ENSPTRP00000034834 ENSPTRP00000034834 ENSP00000260113 ENSP00000428567 NP_001311332.1.87134 NP_001311332.1.92137 NP_056970.1.87134 NP_056970.1.92137 XP_001166363.1.37143 XP_003831351.1.60992 XP_004047214.1.27298 XP_009453803.1.37143 XP_010386308.1.97406 XP_011792565.1.43180 XP_012590802.1.48125 XP_012590803.1.48125 XP_017741337.1.44346 XP_018887559.1.27298 gi|7705676|ref|NP_056970.1| ENSGGOP00000012317 ENSP00000260113 ENSP00000260113 ENSP00000428567 ENSGGOP00000012317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]