SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012319 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012319
Domain Number 1 Region: 177-247
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000347
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 2 Region: 237-297
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000011
Family Complement control module/SCR domain 0.0034
Further Details:      
 
Domain Number 3 Region: 39-158
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000706
Family Growth factor receptor domain 0.021
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000012319
Domain Number - Region: 552-623
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00708
Family Fibronectin type III 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012319   Gene: ENSGGOG00000012620   Transcript: ENSGGOT00000012676
Sequence length 757
Comment pep:known_by_projection chromosome:gorGor3.1:9:94509356:94644993:-1 gene:ENSGGOG00000012620 transcript:ENSGGOT00000012676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRGPWDAGPSRRLLPLLLLLGLARGAAGAPGPDGLDVCATCHEHATCQQREGKKICICN
YGFVGNGRTQCVDKNECQFGATVVCGNHTSCHNTPGGFYCICLEGYRATNNNKTFIPNDG
TFCTDIDECEVSGLCRHGGRCVNTHGSFECYCMDGYLPRNGPEPFHPTTDATSCTEIDCG
TPPEVPDGYIIGNYTSRLGSQVRYACREGFFSVPEDTVSSCTALGTWESPKLHCQEINCG
NPPEMRHAILVGNHSSRLGGVARYVCQEGFESPGGKITSVCTEKGTWRESTLTCTEILTK
INDVSLFNDTCVRWQINSRRINPKISYVISIKGQRLDPMESVHEETVNLTTDSRTPEVCL
ALYPGTNYTVNISTAPPRRSMPAVIGFQTAEDDLLEDDGSFNISIFNETCLKLNRRSRKV
GSEHMYQFTVLGQRWYLANFSHATSFNFTTREQVPVVCLDLYPTTDYTVNVTLLRSPKRH
SVQITIATPPAVKQTISNISGFNETCLRWRSIKTADMEEMYLFHIWGQRWYQKEFAQEMT
FNISSSSRDPEVCLDLRPGTNYNVSLRALSSELPVVISLTTQITEPPLPEVEFFTVHRGP
LPRLRLRKAKEKNGPISSYQVLVLPLALQSTFSCDSEGASSFFSNASDAGGYVAAELLAK
DVPDDAMEIPVGDRLYYGEYYNAPLKRGSDYCIILRITSEWNKVRRHSCAVWAQVKEIPC
NCNFLRLHIHRANSGDTQIRHSCCCRWRVLDWVPWLL
Download sequence
Identical sequences ENSGGOP00000012319 ENSGGOP00000012319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]