SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012326 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012326
Domain Number 1 Region: 24-102
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 4.71e-28
Family Surp module (SWAP domain) 0.0000368
Further Details:      
 
Domain Number 2 Region: 682-791
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.03e-27
Family Ubiquitin-related 0.00000201
Further Details:      
 
Domain Number 3 Region: 136-216
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 3.16e-26
Family Surp module (SWAP domain) 0.0000049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012326   Gene: ENSGGOG00000012631   Transcript: ENSGGOT00000012683
Sequence length 793
Comment pep:known_by_projection chromosome:gorGor3.1:22:14424248:14446517:-1 gene:ENSGGOG00000012631 transcript:ENSGGOT00000012683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAGPVQAVPPPPPVPTEPKQPTEEEASSKEDSAPSKPVVGIIYPPPEVRNIVDKTASFV
ARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQ
QQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQ
FLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLFSKLKKEAENPREVL
DQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTT
PEELGARILIQERYEKFGESEEVEMEVESDEEDDKQEKAEEPPSQLDQDTQVQDMDEGSD
DEEEGQKVPPPPETPMPPPLPPTPDQVIVRKDYDPKASKPLPPAPAPDEYLVSPITGEKI
PASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQLAERRTDIFGVE
ETAIGKKIGEEEIQKPEEKVTWDGHSGSMARTQQAAQANITLQEQIEAIHKAKGLVPEDD
TKEKIGPSKPNEIPQQPPPPSSATNIPSSAPPITSVPRPPTMPPPVRTTVVSAVPVMPRP
PMASVVRLPPGSVIAPMPPIIHXXXXXXXXXXXXXXXXXXXXXXPMIVPTAFVPAPPVAP
VPAPAPMPPVHPPPPMEDEPTSKKLKTEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEW
KLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAV
IHLALKERGGRKK
Download sequence
Identical sequences ENSGGOP00000012326 ENSGGOP00000017948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]