SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012330 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000012330
Domain Number - Region: 111-185
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0504
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012330   Gene: ENSGGOG00000012639   Transcript: ENSGGOT00000012687
Sequence length 187
Comment pep:known_by_projection chromosome:gorGor3.1:19:7889846:7893066:1 gene:ENSGGOG00000012639 transcript:ENSGGOT00000012687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVEEIYKHQEVKMQAPAFKDKKRGVSAKNQGAHDPDYENITLAFKNQDHTKDGHSRLTS
QVPAQCRPPSDSTQVPCWLYRAILSLYILLALAFVLCIILSAFIMVKNAEMSKELLGFKR
ELWNVSNSIQACEERQKRGWDSIQQSITMVRSKVDKLETTLAGIKNIDTKVQKILEVLQK
MPQSSPQ
Download sequence
Identical sequences G3RA72
XP_004059931.1.27298 ENSGGOP00000012330 ENSGGOP00000012330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]