SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012332 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012332
Domain Number 1 Region: 41-271
Classification Level Classification E-value
Superfamily Thiolase-like 1.71e-55
Family Thiolase-related 0.00000552
Further Details:      
 
Domain Number 2 Region: 271-390
Classification Level Classification E-value
Superfamily Thiolase-like 1.25e-37
Family Thiolase-related 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012332   Gene: ENSGGOG00000012640   Transcript: ENSGGOT00000012689
Sequence length 393
Comment pep:known_by_projection chromosome:gorGor3.1:11:105811811:105837598:1 gene:ENSGGOG00000012640 transcript:ENSGGOT00000012689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVLAALLRSDVRSRSPLLRRLVQEIRYVERSYVSKPTLKEVVIVSATRTPIGSFLGSLS
LLPATKLGSIAIQGAIEKAGIPKEEVKEAYMGNVLQGGEGQAPTRQAVLGADVMVAGGME
SMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIHMGSCAENTAKKLNIARNEQDAY
AINSYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKLKTVFQKE
NGTVTAANASTLNDGAAALVLMTADAAKRLNVTPLARIVAFADAAVEPIDFPIAPVYAAS
MVLKDVGLKKEDIAMWEVNEAFSLVVLANIKMLEIDPQKVNINGGAVSLGHPIGMSGARI
VGHLTHALKQGEYGLASICNGGGGASAMLIQKL
Download sequence
Identical sequences ENSGGOP00000012332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]