SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012360 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012360
Domain Number 1 Region: 37-171
Classification Level Classification E-value
Superfamily L domain-like 3.23e-27
Family Rab geranylgeranyltransferase alpha-subunit, C-terminal domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012360   Gene: ENSGGOG00000012667   Transcript: ENSGGOT00000012717
Sequence length 321
Comment pep:known_by_projection chromosome:gorGor3.1:5:36276869:36282005:-1 gene:ENSGGOG00000012667 transcript:ENSGGOT00000012717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGKSAQGPEEGGVCITEALITKRNLTFPEDGELSEKMFHTLDELQTVRLDREGITTIR
NLEGLQNLHSLYLQGNKIQQIENLACIPSLRFLSLAGNQIRQVENLLDLPCLQFLDLSEN
LIETLKLDEFPQSLLILNLSGNSCTNQDGYRELVTEALPLLLDLDGQPVVERWISDEEDE
ASSDEEFPELSGPFCSERGFLKELEQELSRHREHRQQMALTEHLLRMEMQPTLTDLPLLP
GVPMAGDSSPSATPAQGEETVPEAVSSPQASSPTKKPCSLIPRGHQSSLWGRKGAQAATA
PKASVAEAPSTTKTTAKRSKK
Download sequence
Identical sequences A0A2I2ZYI7
ENSGGOP00000012360 XP_004041508.1.27298 ENSGGOP00000012360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]