SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012367 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012367
Domain Number 1 Region: 368-482,602-748
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.52e-65
Family Phosphate binding protein-like 0.00000000066
Further Details:      
 
Domain Number 2 Region: 9-344
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.73e-50
Family L-arabinose binding protein-like 0.01
Further Details:      
 
Domain Number 3 Region: 498-601
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000267
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012367   Gene: ENSGGOG00000012673   Transcript: ENSGGOT00000012724
Sequence length 837
Comment pep:known_by_projection chromosome:gorGor3.1:4:167593333:167739468:1 gene:ENSGGOG00000012673 transcript:ENSGGOT00000012724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTL
HVSFITPSFPTDGTHPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDS
AAEKKWQVTAINVGNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDRIVYQVITI
GKHVKGYHYIIANLGFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYP
GAHTTTIKYTSALTYDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIER
ALKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGN
DTSGLENKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIV
GDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIK
KPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSS
ESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLT
VERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRT
TAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRTP
VNLAVLKLSEQGVLDKLKNKWWYDKGECGAKDSGSKEKTSALSLSNVAGVFYILVGGLGL
AMLVALIEFCYKSRAEAKRMKVAKNAQNINPSSSQNSQNFATYKEGYNVYGIESVKI
Download sequence
Identical sequences ENSGGOP00000012367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]