SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012369 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012369
Domain Number 1 Region: 435-493
Classification Level Classification E-value
Superfamily EF-hand 0.00000249
Family Calmodulin-like 0.028
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000012369
Domain Number - Region: 97-223
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00785
Family Hemolysin E (HlyE, ClyA, SheA) 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012369   Gene: ENSGGOG00000012677   Transcript: ENSGGOT00000012726
Sequence length 495
Comment pep:known_by_projection chromosome:gorGor3.1:1:48314258:48358133:-1 gene:ENSGGOG00000012677 transcript:ENSGGOT00000012726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKRKELNALIGLAGDSRRKKPKKGPSSHRLLRTEPPDSDSESSSEEEEEFGVVGNRSRF
AKGDYLRCCKICYPLCGFVILAACVVACVGLVWMQVALKEDLDALKEKFRTMESNQKSSF
QEIPKLNEELLSKQKQLEKIESGEMGLNKVWINITEMNKQISLLTSAVNHLKANVKSAAD
LISLPTTVEGLQKSVASIGNTLNSVHLAVEALQKTVDEHKKTMELLQSDMNQHFLKETPG
SNQIIPSPSATSELDNKTHSENLKQDILYLHNSLEEVNSALVGYQRQNDLKLEGMNKTVS
NLTQRVNLIESDVVAMSKVEKKANLSFSMMGDRFATLKRESLDQVTNRTDTVKIQSIKKE
DSSNSQVSKLREKLQLISALTNKPESNRPPETADEEQVESFTSKPSALPKFSQFLGDPVE
KAAQLRPISLPGVSSTEDLQDLFRKTGQDVDGKLTYQEIWTSLGSAMPEPESLRAFDSDG
DGRYSFLELRAALGI
Download sequence
Identical sequences G3RAA3
ENSGGOP00000012369 ENSGGOP00000012369 XP_004025785.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]