SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012393 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012393
Domain Number 1 Region: 68-458
Classification Level Classification E-value
Superfamily Ras GEF 2.62e-95
Family Ras GEF 0.00044
Further Details:      
 
Domain Number 2 Region: 554-608
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000897
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0016
Further Details:      
 
Domain Number 3 Region: 467-548
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000115
Family Polcalcin 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012393   Gene: ENSGGOG00000012695   Transcript: ENSGGOT00000012750
Sequence length 668
Comment pep:known_by_projection chromosome:gorGor3.1:11:61554523:61573640:-1 gene:ENSGGOG00000012695 transcript:ENSGGOT00000012750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRLCGRGTQGWPGSSEQHVQEATSSAGLHSGVDELGVRSEPGGRLPERSLGPAHPAPAAM
AGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIYQ
QSRKDNSNSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDI
DSVPTYKWKRQVTQRNPVGQKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHSF
VTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTAPQRALVITHFVHVAEKLLQLQNFN
TLMAVVGGLSHSSISRLKETHSHVSPETIKLWEGLTELVTATGNYGNYRRRLAACVGFRF
PILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSLRPPVQANPDLL
SLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLDQA
LVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEMV
SYFLRSSSVLGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQCK
DRVSVECRRRAQSVSLEGSAPSPSPTHSHHHRAFSFSLPRPGRRGSRPPEIREEEVQTVE
DGVFDIHL
Download sequence
Identical sequences ENSGGOP00000012393 ENSGGOP00000012393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]