SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012459 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012459
Domain Number 1 Region: 212-325
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.37e-21
Family Voltage-gated potassium channels 0.0042
Further Details:      
 
Domain Number 2 Region: 32-65,108-177
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.23e-19
Family Voltage-gated potassium channels 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012459   Gene: ENSGGOG00000012778   Transcript: ENSGGOT00000012820
Sequence length 430
Comment pep:known_by_projection chromosome:gorGor3.1:2a:48336398:48385681:-1 gene:ENSGGOG00000012778 transcript:ENSGGOT00000012820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRSPRPPPRRSRRRLPRPSCCCCCCRRSHLNEDTGRFVLLAALIGLYLVAGATVFSAL
ESPGEAEARARWGATLRNFSAAHGVAEPELRAFLRHYEAALAAGVRADALRPRWDFPGAF
YFVGTVVSTIGFGMTTPATVGGKAFLIAYGLFGCAGTILFFNLFLERIISLLAFIMRACR
ERQLRRSGLLPATFRRGSALSEADSLAGWKPSVYHVLLILGLFAVLLSCCASAMYTSVEG
WDYVDSLYFCFVTFSTIGFGDLVSSQHAAYRNQGLYRLGNFLFILLGVCCIYSLFNVISI
LIKQVLNWMLRKLSCRCCARCCPAPGAPLARRNAITPGSRLRRRLAALGADPAARDSDAE
GRRLSGELISMRDLTASNKVSLALLQKQLSETANGYPRSVCVNTRQNGFSGGVGALGIMN
NRLAETSASR
Download sequence
Identical sequences A0A2I2YZD1 A0A2I3S4S2 A0A2J8XD36 Q9HB15
ENSPTRP00000020432 ENSPTRP00000020432 ENSGGOP00000012459 NP_071338.1.87134 NP_071338.1.92137 XP_004029251.1.27298 XP_515460.2.37143 ENSP00000327611 9598.ENSPTRP00000020432 9606.ENSP00000327611 ENSP00000327611 ENSP00000327611 gi|11545761|ref|NP_071338.1| ENSGGOP00000012459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]