SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012471 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012471
Domain Number 1 Region: 12-171
Classification Level Classification E-value
Superfamily EF-hand 3.29e-44
Family Calmodulin-like 0.0000614
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012471   Gene: ENSGGOG00000012797   Transcript: ENSGGOT00000012832
Sequence length 201
Comment pep:known_by_projection chromosome:gorGor3.1:6:43402287:43426528:1 gene:ENSGGOG00000012797 transcript:ENSGGOT00000012832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMF
ETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIR
AINPCSDSTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIV
RRLQNGEQDEEGADEAAEAAG
Download sequence
Identical sequences G3RAJ8
XP_004044059.1.27298 XP_004044060.1.27298 XP_004044061.1.27298 ENSGGOP00000012471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]