SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012483 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012483
Domain Number 1 Region: 997-1292
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-64
Family Protein kinases, catalytic subunit 0.0000407
Further Details:      
 
Domain Number 2 Region: 132-231
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000405
Family N-terminal PAS domain of Pas kinase 0.00000563
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000012483
Domain Number - Region: 244-314
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00096
Family Heme-binding PAS domain 0.014
Further Details:      
 
Domain Number - Region: 347-389
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00419
Family Heme-binding PAS domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012483   Gene: ENSGGOG00000012790   Transcript: ENSGGOT00000012844
Sequence length 1330
Comment pep:known_by_projection chromosome:gorGor3.1:2b:130569854:130617762:-1 gene:ENSGGOG00000012790 transcript:ENSGGOT00000012844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGGLTAFEEDQRCLSQSLPLPVSAEGPAAQTTAEPSRSFSSAHRHLSRRNGLSRLCQS
RTALSEDRWSSYCLSSLAAQNICTSKLHCPAAPEHTDPSEPRGSVSCCSLLQGLSSGWSS
PLLPAPVCNPNKAIFTVDAKTTEILVANDKACRLLGYSSQDLIGQKLTQFFLRSDSDVVE
ALSEEHMEADGHAAVVCGTVVDIISRSGEKIPVSVWMKRMRQEHRLCCVVVLEPVERVST
WVAFQSDGTVTSCDSLFAHLHGYVSGEDVAGQHITDLIPSVQLPPSGQHIPKTLKIQRSV
GRARDGTTFPLSLKLKSQPSSEEATTGEAAPVRGYRASVWVFCTISGLITLLPDGTIHGI
NHSFALTLFGYGKTELLGKNITFLIPGFYSYMDLAYNSSLQLPDLASCLDVGDESGCGER
TLDPWQGQDPAEGAQDPRINVVLAGGHIVPRDETRKLMESQDIFTGTQTELGAGGQFLSC
LSPQPAPGVDSVPEGSLPVHGEQALPEDQQITALGREEPVAIESPGQDLLGESSSERVDV
KPFASCEDSEAPVPAEDGGSDAGMCGLCQKAQLERMGVSGPSSSDLWAGAAVAEPQAKGQ
LAGGSLLMHCPCYGSEWGLRWRSQELVPSPSGMAGLSFGTPTPDEPWLGVENDREELQTC
LIKEQLSQLSLAGALDVPHAELVPTECPAVTAPVSSCDLGGRDLYGGCTGSSSACYALAT
DLPGGLEAVEAQEVDVNSFSWNLKELFFSDQTDQTSSNCSCATSELREAPSSLAAGSDPD
VGSLQEQGSCVLDDRELLLLTGTCVDLGQGRRFRESCVGHDPTEPLEVCLVSSEHYAASD
RESPGRVPSMLDAGPEDTCPSAEEPRLNVQVTSTPVIVMRGAAGLQREIQEGAYSGSCYH
RDGLRLSIQFEVRRVELQGPTPLFCCWLVKDLLHSQRDSASRTRLLLASLPGSTHSTAAE
LTGPSLVEVLRARPWFEEPHKAVELEGLAACEGEYSQKYSTLSPLGSGAFGFVWTAVDKE
KNKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVEHANIIKVLDVFENQGFFQLV
MEKHGSGLDLFAFIDRHPRLDEPLASYIFRQVRAGQSRLVSAVGYLRLKDIIHRDIKDEN
IVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTL
YTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPEKRTTLEKLVTDPWVTQ
PVNLADYTWEEVCPVNKPESGVLSTASLEMGNRSLSDVAQAQELCGGPIPGEAPNGQGCL
HPGDPRLLTS
Download sequence
Identical sequences ENSGGOP00000012483 ENSGGOP00000012483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]