SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012489 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012489
Domain Number 1 Region: 703-1009
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.47e-72
Family Protein kinases, catalytic subunit 0.00000629
Further Details:      
 
Domain Number 2 Region: 1696-1884
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.13e-40
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 3 Region: 198-318
Classification Level Classification E-value
Superfamily PH domain-like 3.16e-31
Family Pleckstrin-homology domain (PH domain) 0.0007
Further Details:      
 
Domain Number 4 Region: 2-176
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.79e-28
Family DBL homology domain (DH-domain) 0.00035
Further Details:      
 
Domain Number 5 Region: 598-690
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-21
Family I set domains 0.0042
Further Details:      
 
Domain Number 6 Region: 419-517
Classification Level Classification E-value
Superfamily Immunoglobulin 6.77e-21
Family I set domains 0.0091
Further Details:      
 
Domain Number 7 Region: 318-415
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-20
Family I set domains 0.0061
Further Details:      
 
Domain Number 8 Region: 1571-1658
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000762
Family Fibronectin type III 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012489   Gene: ENSGGOG00000012717   Transcript: ENSGGOT00000012851
Sequence length 1884
Comment pep:known_by_projection chromosome:gorGor3.1:1:208553346:208594090:1 gene:ENSGGOG00000012717 transcript:ENSGGOT00000012851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVIQELLSSEQAFVEELQFLQSHHLQHLERCPHVPAAVAGQKAVIFRNVRDIGRFHSSSF
LQELQQCDTDDDVAMCFIKNQAAFEQYLEFLVGRVQAESVVVSTAIQEFYKKYAEEALLA
GDPSQPPPPPLQHYLEQPVERVQRYQALLKELIRNKARNRQNCALLEQAYAVVSALPHPL
PQRAENKLHVSLMENYPGTLEALGEPIRQGHFIVWEGAPGARMPWKGHNRHVFLFRNHLV
ICKPRRDSRTDTFSYVFRNMMKLSSIDLNDQVEGDDRAFEVWQEREDSVRKYLLQARTAI
IKSSWVKEICGIQQRLALPVWRPPDFEEELADCTAELGETVKLACRVTGTPKPVISWYKD
GKPVQVDPHHILIEDPDGSCALILDSLTGVDSGQYMCFAASAAGNCSTLGKILVQVHNPT
VPPRFVNKVRASPFVEGEDAQFTCTIEGTPYPQIRWYKDGALLTTGNKFQTLSEPRSGLL
VLVIRAAGKEDLGLYECELVNRLGSARASAELHIQSPTLQSREQCHREQLVAAVEGEGAS
VRGLAPLFRHAGCQAGLPQPWAAGTVVMADGAEAASTPDRPDQTGCYKSQSSLPALPGPP
SMQVTIEDVQAQTGGTAQFEAIIEGDPQPSVTWYKDSVQLVDSTRLSQQQEGTTYSLVLR
HVASKDAGVYTCLAQNAGGQVLCKAELLVLGGDNEPDSEKQSHRRKLHSFYEVKEEIGRG
VFGFVKRVQHKGNKILCAAKFIPLRSRTRAQAYRERDILAALSHPLLTGLLDQFETRKTL
ILILEDPRCSSEELLDRLFRKGVVTEAEVKVYIQQLVEGLHYLHSHGVLHLDIKPSNILM
VHPAREDIKICDFGFAQNITPAELQFSQYGSPEFVSPEIIQQNPVSEASDIWAMGVISYL
SLTCSSPFAGESDRATLLNVLEGRVSWSSPMAAHLSEDAKDFIKATLQRAPQARPSAAQC
LSHPWFLKSMPAEEAHFINTKQLKFLLARSRWQRSLMSYKSILVMRSIPELLRGPPDSPS
LGVARHLCRDTGGSSSSSSSSDNELAPFARAKSLPPSPVTHSPLLHPRGFLRPSASLPEE
AEXLLAKAPSFETALRLPASGTHLAPGHSHSLEHDSLSTPRPSPEACAPSGGPPIRDMGH
PQGSKQLPSTGGHPGTAQPERPSPDSPWGQPAPFCHPKQGSAPQEGCSPHPAVAPCPPGS
FPPGSCKEAPLVPSSPFLGQPQAPPAPAKASPPLDSKMGPGDISLPGRPKPGPCSSPGSA
SQASSSQVSSLRVGSSQVGTEPGPSLDAEGWSQEAEDLSDSTPTLQRPQEQATTRKFSLG
CHGGYAGVAGYGTFAFGGDAGGMLGQGPMWARIAWAVSQSEEEEQEEARAESPLPQSPPH
GRTSGRSPWCRSGTCQVMRRRPTQYPWTFPRWTPPTSTSQTCTISRKSRSLLSQSRPPPW
LRRSWPSSRSPRGPGQAAVGRKRKWSSPSRRLFHFPGRHLPLDEPAELGLRERVKASVEH
ISRILKGRPEGEPPPHPKHPACPGAPILYLRLLHSRPSPTPCLEKEGPPRKKPGLASFRL
SGLKSWDRERPSSSPCPDIGEVYADGVLLVWKPLESYGPVTYIVQCSLEGGSWTTLASDI
FDCCYLTSKLSRGGTYTFRTACVSKAGMGPYSSPSKQVLLGGPSHLDLAELGSCCSECWE
SGNGRGPPTSLTAVPLSRGRFSVVRQCWEKASGRALAAKIIPYHPKDKTAVLREYEALKG
LRHPHLAQLHAAYLSPRHLVLILELCSGPELLPCLAERASYSESEVKDYLWQMLSATQYL
HNQHILHLDLRSENMIITEYNLLKVVDLGNAQSLSQEKVLPSEKFKDYLETMAHVPLPAP
ELLEGQGAVPQTDIWSIGVTAFIM
Download sequence
Identical sequences ENSGGOP00000012489 ENSGGOP00000012489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]