SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012493 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012493
Domain Number 1 Region: 79-354
Classification Level Classification E-value
Superfamily L domain-like 1.36e-54
Family Internalin LRR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012493   Gene: ENSGGOG00000012805   Transcript: ENSGGOT00000012855
Sequence length 360
Comment pep:known_by_projection chromosome:gorGor3.1:2b:130618789:130652400:1 gene:ENSGGOG00000012805 transcript:ENSGGOT00000012855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPE
EEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQ
SLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIE
NLSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSN
RLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQE
FWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATFVRF
Download sequence
Identical sequences A0A140VK83 G3RAM0 Q15435
gi|4506013|ref|NP_002703.1| ENSP00000234038 ENSP00000385657 9606.ENSP00000234038 ENSP00000234038 ENSP00000385657 ENSGGOP00000012493 NP_002703.1.87134 NP_002703.1.92137 XP_003813113.1.60992 XP_004033524.1.27298 ENSGGOP00000012493 ENSP00000385022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]