SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012529 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012529
Domain Number 1 Region: 3656-4027
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.31e-102
Family Regulator of chromosome condensation RCC1 0.0012
Further Details:      
 
Domain Number 2 Region: 2665-3033
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.66e-100
Family Regulator of chromosome condensation RCC1 0.0013
Further Details:      
 
Domain Number 3 Region: 4166-4495
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 4.71e-86
Family Hect, E3 ligase catalytic domain 0.0000385
Further Details:      
 
Domain Number 4 Region: 397-747
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.4e-80
Family Regulator of chromosome condensation RCC1 0.007
Further Details:      
 
Domain Number 5 Region: 2436-2618
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.11e-32
Family APC10-like 0.0064
Further Details:      
 
Domain Number 6 Region: 1834-1900
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 2.48e-21
Family Mib/herc2 domain 0.00013
Further Details:      
 
Domain Number 7 Region: 2276-2338
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 5.72e-20
Family CPH domain 0.0023
Further Details:      
 
Domain Number 8 Region: 1177-1260
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 0.0000000000000458
Family Cytochrome b5 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000012529
Domain Number - Region: 3324-3414
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0188
Family Spermadhesin, CUB domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012529   Gene: ENSGGOG00000012785   Transcript: ENSGGOT00000012891
Sequence length 4541
Comment pep:known_by_projection chromosome:gorGor3.1:15:6848887:7078059:-1 gene:ENSGGOG00000012785 transcript:ENSGGOT00000012891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAFTRDGLCGLWNEMVKDGEIVYTGTESTQNGELPPRKDDSVEPSGTKKEDLNDKEKKDE
EETPAPIYRAKSILDSWVWGKQPDVNELKECLSVLVKEQQALAVQSATTTLSALRLKQRL
VILERYFIALNRTVFQENVKVKWKSSGISLPPVDKKSSRPLRKGVEGLARVGSRAALSFA
FAFLRRAWRSGEDADLCSELLQESLDALRALPEASLFDESTMASVWLEVVERATRFLRSV
VTGDVHGTPGTKGPSVRLQDQHLALAILLLVAVQRGTLSLPMLSAILLLLQLWDSGAQET
DNERSAGTSAPLLPLLQRFQSIICRKDTPHSEGDMHLLSGPLSPNESFLRYLTLPQDNEL
AIDLRQTAVVVMAHLDRLATPCMPPLCSSPTSHKGSLQEVIGWGLIGWKYYANVIGPIQC
KGLANLGVTQIACAEKRLLIRNGRVTQAYNSDTLVPQLVQGLASRNVVKIAAHSDGHHYL
ALAATGEVYSWGCGDGRRLGHGDTVPLEEPKVISAFSGKQAGKHVVHIACGSTYSAAITA
EGELYTWGRGNYGRLGHGSSEDEAIPMLVAGLKGLKVIDVACGSGDAQTLAVTENGQVWS
WGDGDYGKLGRGGSDGCKTPKLIEKLQDLDVVKVRCGSQFSIALTKDGQVYSWGKGDNQR
LGHGTEEHVRYPKLLEGLQGKKVIDVAAGSTHCLALTEDSEVHSWGSNDQCQHFDTLRVT
KPEPAALPGLDTKHIVGIACGPAQSSAGSSYEWSMGLCVPQGGDIRSTTSEQLDLLLRQV
SEGMEGSADWPPPQEKECVAVATLNLLRLQLHAAISHQVDPEFLGLGLGSILLNSLKQTV
VTLASSAGVLSTVQSAAQAVLQSGWSVLLPTAEERARALSALLPCAVSGNEVNISPGRRF
MIDLLVGSLMADGGLESALHAAITAEIQDIEAKKEAQKEKEIDEQEVNASTFHRSRTPLD
KDLINTGICESSGKQCLPLVQLIQQLLRNIASQTVARLKDVARRISSCLDFEQHSRERSA
SLDLLLRFQRLLISKLYPGESIGQTSDISSPELMGVGSLLKKYTALLCTHIGDILPVAAS
IASTSWRHFAEVACIVEGDFTGVLLPELVVSIVLLLSKNAGLMQEAGAVPLLGGLLEHLD
RFNHLAPGKERDDHEELAWPGIMESFFTGQNCRNNEEVTLIRKADLENHNKDGGFWTVID
GKVYDIKDFQTQSLTGNSILAQFAGEDPVVALEAALQFEDTRESMHAFCVGQYLEPDQEI
VTIPDLGSLSSPLIDTERNLGLLLGLHASYLAMSTPLSPVEIECAKWLQSSIFSGGLQTS
QIHYSYNEEKDEDHCSSPGGTPASKSRLCSHRRALGDHSQAFLQAIADNNIQDHNVKDFL
CQIERYCRQCHLTTPIMFPPEHPVEEVGRLLLCCLLKHEDLGHVALSLVHAGALGIEQVK
HRTLPKSVVDVCRVVYQAKCSLIKTHQEQGRSYKEVCAPVIERLRFLFNELRPAVCNDLS
IMSKFKLLSSLPRWRRIAQKIIRERRKKRVPKKPESSDDEEKIGNEESDLEEACILPHSP
INVDKRPIAIKSPKDKWQPLLSTVTGVHKYKWLKQNVQGLYPQSPLLSTIAEFALKEEPV
DVEKMRKCLLKQLERAEVRLEGIDTILKLASKNFLLPSVQYAMFCGWQRLIPEGIDIGEP
LTDCLKDVDLIPPFNRMLLEVTFGKLYAWAVQNIRNVLMDASAKFKELGIQPVPLQTITN
ENPSGPSLGTIPQARFLLVMLSMLTLQHGANNLDLLLNSGMLALTQTALRLIGPSCDNVE
EDMNASAQGASATVLEETRKETAPVQLPVSGPELAAMMKIGTRVMRGVDWKWGDQDGPPP
GLGRVIGELGEDGWIRVQWDTGSTNSYRMGKEGKYDLKLAELPAAAQPSAEDSDTEDDSE
AEQTERNIHPTAMMFTSTINLLQTLCLSAGVHAEIMQSEATKTLCGLLRMLVESGTTDKT
SSPNRLVYREQHQSWCTLGFVRSIALTPQVCGALSSPQWITLLMKVVEGHAPFTATSLQR
QILAVHLLQAVLPSWDKTERARDMKCLVEKLFDFLGSLLTTCSSDVPLLRESTLRRRRLR
PQASLTATHSSTLAEEVVALLRTLHSLTQWNGLINKYINSQLRSITHSFAGRPSEGAQLE
DYFPDSENPEVGGLMAVLAVIGGIDGRLRLGGQVVHDEFGEGTVTRITPKGKITVQFSDM
RTCRVCPLNQLKPLPAVAFNVNNLPFTEPMLSVWAQLVNLAGSKLEKHKINKSTKQAFAV
GMMVRCCRAYEEVCEGDVGKVIKLDRDGLHDLNVQCDWQQKGGTYWVRYIHVELIGYPPP
SSSSHIKIGDKVRVKASVTTPKYKWGSVTHQSVGVVKAFSANGKDIIVDFPQQSHWTGLL
SEMELVPSIHPGVTCDGCQMFPINGSRFKCRNCDDFDFCETCFKTKKHNTRHTFGRINEP
GQSAVFCGRSGKQLKRCHSSQPGMLLDSWSRMVKSLNVSSSVNQASRLIDGSEPCWQSSG
SQGKHWIRLEIFPDVLVHRLKMIVDPADSSYMPSLVVVSGGNSLNNLIELKTININPSDT
TVPLLNDCTEYHRYIEIAIKQCRSSGIDCKIHGLILLGRIRAEEEDLAAVPFLASDNEEE
EDEKGNSGSLIRKKAAGLESAATIRTKVFVWGLNDKDQLGGLKGSKIKVPSFSETLSALN
VVQVAGGSKSLFAVTVEGKVYACGEATNGRLGLGISSGTVPIPRQITALSSYVVKKVAVH
SGGRHATALTVDGKVFSWGEGDDGKLGHFSRMNCDKPRLIEALKTKRIRDIACGSSHSAA
LTSSGELYTWGLGEYGRLGHGDNTTQLKPKMVKVLLGHRVIQVACGSRDAQTLALTDEGL
VFSWGDGDFGKLGRGGSEGCNIPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGD
YFRLGHGSDVHVRKPQVVEGLRGKKIVHVAVGALHCLAVTDSGQVYAWGDNDHGQQGNGT
TTVNRKPTLVQGLEGQKITRVACGSSHSVAWTTVDVATPSVHEPVLFQTARDPLGASYLG
VPSDADSSAASNKISGASNSKPNRPSLAKILLSLDGNLAKQQALSHILTALQIMYARDAV
VGALMPAAMIAPVECPSFSSAAPSDASAMASPMNGEECMLAVDIEDRLSPNPWQEKREIV
SSEDAVTPSAVTPSAPSASARPFIPVTDDLGAASIIAETMTKTKEDVESQNKAAGPEPQA
LDEFTSLLIADDTRVVVDLLKLSVCSRAGDRGRDVLSAVLSGMGTAYPQVADMLLELCVT
ELEDVATDSQSGRLSSQPVVVESSHPYTDDTSTSGTVKIPGAEGLRVEFDRQCSTERRHD
PLTVMDGVNRIVSVRSGREWSDWSSELRIPGDELKWKFISDGSVNGWGWRFTVYPIMPAA
GPKELLSDRCVLSCPSMDLVTCLLDFRLNLASNRSIVPRLAASLAACAQLSALAASHRMW
ALQRLRKLLTTEFGQSININRLLGENDGEARALSFTGSALAALVKGLPEALQRQFEYEDP
IVRGGKQLLHSPFFKVLVALACDLELDTLPCCAETHKWAWFRRYCMASRVAVALDKRTPL
PRLFLDEVAKKIRELMADSENMDVLHESHDIFKREQDEQLVQWMNRRPDDWTLSAGGSGT
IYGWGHNHRGQLGGIEGAKVKVPTPCEALATLRPVQLIGGEQTLLAVTADGKLYATGYGA
GGRLGIGGTESVSTPTLLESIQHVFIKKVAVNSGGKHCLALSSEGEVYSWGEAEDGKLGH
GNRSPCDRPRVIESLRGIEVVDVAAGGAHSACVTAAGDLYTWGKGRYGRLGHSDSEDQLK
PKLVEALQGHRVVDIACGSGDAQTLCLTDDDTVWSWGDGDYGKLGRGGSDGCKVPMKIDS
LTGLGVVKVECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDHVRRPRQVQGLQGKKVIA
IATGSLHCVCCTEDGEVYTWGDNDEGQLGDGTTNAIQRPRLVAALQGKKVNRVACGSAHT
LAWSTSKPASAGKLPAQVPMEYNHLQEIPIIALRNRLLLLHHLSELFCPCIPMFDLEGSL
DETGLGPSVGFDTLRGILISQGKEAAFRKVVQATMVRDRQHGPVVELNRIQVKRSRSKGG
LAGPDGTKSVFGQMCAKMSSFGPDSLLLPHRVWKVKFVGESVDDCGGGYSESIAEICEEL
QNGLTPLLIVTPNGRDESGANRDCYLLSPAARAPVHSSMFRFLGVLLGIAIRTGSHLSLN
LAEPVWKQLAGMSLTIADLSEVDKDFIPGLMYIRDNEATSEEFEAMSLPFTVPSASGQDI
QLSSKHTHITLDNRAEYVRLAINYRLHEFDEQVAAVREGMSRVVPVPLLSLFTGYELETM
VCGSPDILLHLLKSVATYKGIEPPASLIQWFWEVMESFSNTEHSLFLRFVWGRTRLPRTI
ADFRGRDFVIQVLDKYNPPDHFLPESYTCFFLLKLPRYSCKQVLEEKLKYAIHFCKSIDT
DDYARIALTGEPAADDSSDDSDNEDVDSFASDSTQDYLTGH
Download sequence
Identical sequences ENSGGOP00000012529 ENSGGOP00000012529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]