SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012554 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012554
Domain Number 1 Region: 54-132
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000527
Family S100 proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012554   Gene: ENSGGOG00000012870   Transcript: ENSGGOT00000012916
Sequence length 147
Comment pep:known_by_projection chromosome:gorGor3.1:3:65219545:65230953:1 gene:ENSGGOG00000012870 transcript:ENSGGOT00000012916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGCMHSTQDKSLHLEGDPNPSAAPTSTCAPRKMPKSISISKQLASVKALRKCSDLEKAI
ATTALIFRNSSDSDGKLEKAVAKDLLQTQFRNFTEGQETKPKYREILSELDEHTENKLDF
EDFMILLLSITVMSDLLQNIRSVKIMK
Download sequence
Identical sequences G3RAS7
XP_004035890.1.27298 ENSGGOP00000012554 ENSGGOP00000012554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]