SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012555 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012555
Domain Number 1 Region: 313-434
Classification Level Classification E-value
Superfamily EF-hand 6.84e-33
Family Osteonectin 0.0093
Further Details:      
 
Domain Number 2 Region: 222-294
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.11e-20
Family Thyroglobulin type-1 domain 0.0014
Further Details:      
 
Domain Number 3 Region: 75-158
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 8.37e-20
Family Thyroglobulin type-1 domain 0.0012
Further Details:      
 
Domain Number 4 Region: 40-86
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000402
Family Ovomucoid domain III-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012555   Gene: ENSGGOG00000012868   Transcript: ENSGGOT00000012917
Sequence length 457
Comment pep:known_by_projection chromosome:gorGor3.1:6:169597464:169832329:1 gene:ENSGGOG00000012868 transcript:ENSGGOT00000012917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPQLCWLPLLAGLLPPVPAQKFSALTFLRVDQDKDKDCSLDCAGSPQKPLCASDGRTF
LSRCEFQRAKCKDPQLEIAYRGNCKDVSRCVAERKYTQEQARKEFQQVFIPECNDDGTYS
QVQCHSYTGYCWCVTPNGRPVSGTAVAHKMPRCPGSVNEKLPQREGTGKTVSLQIFSVLN
SDDAAAPALETQPQGDEEDIASRYPTLWTEQVKSRQNKTNKNSVSSCDQEHQSALEEAKQ
PKNDNVVIPECAHGGLYKPVQCHPSTGYCWCVLVDTGRPIPGTSTRYEQPKCDNTARAHP
AKARDLYKGRQLQGCPGAKKHEFLTSVLDALSTDMVHAVSDPSSSSGRLSEPDPSHTLEE
RVVHWYFKLLDKNSSGDIGKKEIKPFKRFLRKKSKPKKCVKKFVEYCDVNNDKSISVQEL
MGCLGVAKEDGKADTKKRHTPRGNAESTSNRQPRKQG
Download sequence
Identical sequences G3RAS8
ENSGGOP00000012555 ENSGGOP00000012555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]