SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012563 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012563
Domain Number 1 Region: 759-917
Classification Level Classification E-value
Superfamily L domain-like 1.13e-21
Family Ngr ectodomain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012563   Gene: ENSGGOG00000012882   Transcript: ENSGGOT00000012925
Sequence length 1590
Comment pep:novel chromosome:gorGor3.1:10:30462476:30468198:-1 gene:ENSGGOG00000012882 transcript:ENSGGOT00000012925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAHCAVPACVMSLLCFWGLWPLLTWQLLWLLVKEAQPLEWVKDLLQLTSNPRGPPEPW
SSSSHLPWESPHAPIAPADPGDFDYLGPSASSQMSAPPQQSTENLVAFLDTDSAGELPLG
PEQFSVAHQDFNDKLTLQERLPVSPRNLKKDLAQHWSIADIVGIPQQLSKPQRKQTLQDE
YSSMDTQYPGSLPPELWVNSNEPPGSPEVGLSQFHLEPETENPETLEDIQSSSLQEEAPA
QLPQLLSTQQEAPALPPESSMESLAQTLPNHEVTVQPPGEDQAHYNLPNITVKPADVEVT
ITSEPTNEKESSQAQQEAPVQFPEEVEPSATQQAPTEPPCHPTERELSISEQEQPAQPSE
SSGEVESSQTRQETPAPLEEMEPPANQEEAPTEPPGPPVEPELSPSEQEQPAQPSAQPPE
LPNVVVTQPPEHSNLTQATVQPLDLGLTITPESTTEVELSPTMQETPTHPPKKVVPQLPV
YQEVTIPTPGQDQAQHPMSPSITVQPLDLGLTITPEPTTEVGHSTPLKKNVVPPKHPKAT
LPHPDQVQTQHSNLTQATVQPLDLGLTITPESTTEVEPSAALTTTAPPPEHPEVTLPPSD
KGRAQHSNLTQVTLPPLDLEFTITTEPTTEVKPSPTMEETSTQPPDLGLAITPEPTTETG
HSTALEKTTAPRPDQVQTLHRKLTEVTGPPTELEPTQDSLVQSESYAQNKALTAPEEQAS
TSTNICELCTCGDETLSCIDLSPKQRLYQVPVPEPNTYHGTFTILNFQGNYISYIDGNVW
KAYGTGKLILNENYLTELHNDSFEGLLSLQYLDLSCNKIQSIERHTFEPLPFLQFINLGC
NLLTELSFGTFQAWHGMQFLHKLILNRNPLITVEDPYLFKLSAFKYLDMGTTQVPLTTIE
NILVMTVELEKLILPSHMTCCLCQFKNSIEAVCKRVKLHCNSACLTNTIHCEEASVENPG
VFMKVLQAQKKHTSTELTIEPEAASDSNGINLSGFGSGQLDTNDERDVISALSYILPYFS
AVNLDVKSILLPFINLLTTGNSLAKIQSVGKNLQRVNRVLMGPRSILKRHFKEGKQRIRR
EQGAQAFAENAAKEKRLGSPAPRELRQPHIEQGPEKLVGNTIYTKPSFIQEHKATVSSAL
KPFSMGVPSASTPAKALPQVRDRAKDLTYTIFILENAKARVKNMKAAKPIIHSRKKYRFH
KTCSRVAHRTLKAKKSPKFRKKSYLNRLMLAKRPPFSAVNSLINSLSQRAFSSLGDPSPQ
ENPFPEVFAPSERFIENTNVKNTTARNAFEENIFMENTTRPEGTISENTTHNHPPEADSA
GTAFNLGPTIKQTETKWEYSNMGTDLSPEPKSFNYPLFSSPGDQFEIQLTQQPRSFIPNN
NVRRLISHVIRTLKMDCSETHVQLTCAKLISRTGLLMKLLSEQQEVKVSKAEWDTDWKTE
NYINESTEAQNEEKEQKSSELTKEVPGYGYNNKLILAIFVTEILTTLIIIFCLIEIYSHR
WSSQEDGEGFSRGIFRFLSQRRCSSRSETQDESFSFRQPLWLKDMYKPLSATRVNNQAWK
LHKKSSNEDEIPIDSETPTERGEESEALPR
Download sequence
Identical sequences ENSGGOP00000012563 ENSGGOP00000012563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]