SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012568 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012568
Domain Number 1 Region: 81-218
Classification Level Classification E-value
Superfamily L domain-like 2.72e-34
Family Ngr ectodomain-like 0.0021
Further Details:      
 
Domain Number 2 Region: 309-425
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.05e-17
Family Hormone receptor domain 0.008
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000012568
Domain Number - Region: 247-335
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000127
Family I set domains 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012568   Gene: ENSGGOG00000012872   Transcript: ENSGGOT00000012930
Sequence length 1207
Comment pep:known_by_projection chromosome:gorGor3.1:8:37997128:38038711:1 gene:ENSGGOG00000012872 transcript:ENSGGOT00000012930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGAPARLLVPLLPLLPWLLLLLAPEARGAPGCPLPIRSCKCSGERPKGLSGGVPGPARR
RVVCSGGDLPEPPEPGLLPNGTVTLLLSNNKITGLRNGSFLGLSLLEKLDLRNNIISTVQ
PGAFLGLGELKRLDLSNNRIGCLTSETFQGLPRLLRLNISGNIFSSLQPGVFDELPALKV
VDLGTEFLTCDCHLRWLLPWAQNRSLQLSERTLCAYPSALHAQALGSLQEAQLCCEGALE
LHTHHLIPSLRQVVFQGDRLPFQCSASYLGNDTRIRWYHNRAPVEGDEQAGILLAESLIH
DCTFITSELTLSHIGVWASGEWECTVSMAQGNASKKVEIVVLETSASYCPAERVANNRGD
FRWPRTLAGITAYQSCLQYPFTSVPLGGGAPGTRASRRCDRAGRWEPGDYSHCLYTNDIT
RVLYTFVLMPINASNALTLAHQLRVYTAEAASFSDMMDVVYVAQMIQKFLGYVDQIKELI
EVMVDMASNLMLVDEHLLWLAQREDKACSRIVGALERIGGAALSPHAQHISVNARNVALE
AYLIKPHSYVGLTCTAFQRREGGVPGTRPGSPGQNPLPEPEPPADQKLRFRCTTGRPNVS
LSSFHIKNSVALASIQLPPSLFSSLPAALAPPVPPDCTLQLLVFRNGRLFRSHSNTSRPG
AAGPGKRRGVATPVIFAGTSGCGVGNLTEPVEEKNNLGTLLLPGHPLPRGPRLTGPGKRK
AGLGAWRGVHIPHVLLPALSQELSAFPREVGGAGAGLHPVVYPCTALLLLCLFATIITYI
LNHSSIRVSQKGWHMLLNLCFHMAMTSAVFAGGITLTNYQMVCQAVGITLHYSSLSTLLW
MGVKARVLHKELTWRAPPPQEGDPALPTPSPMLRFYLIAGGIPLIICGITAAVNIHNYRD
HSPYCWLVWRPSLGAFYIPVALSLLITWIYFLCAGLRLRGPLAQNPKAGEELRGSTRLRG
SGPLLSDSGSLLATGSARVGTPGPPEDGDSLYSPGVQLGALVTTHFLYLAMWACGALAVS
QRWLPRVVCSCLYGVAASALGLFVFTHHCXRHPNNVHHGRRAHKSRAKGHRAGEACGKNR
LKLLSSESGSLHNSPTDSYLGSSRNSPGAGLQLEGEPMLTPSEGSDTSAAPLSEVGRAGQ
RRSASRDSLKGGGALEKESHRRSYPLNAASLNGAPKGGKYDDVTVMGAEVASGGCMKTGL
WKSETTV
Download sequence
Identical sequences ENSGGOP00000012568 ENSGGOP00000012568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]