SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012588 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012588
Domain Number 1 Region: 53-114
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000000485
Family Ngr ectodomain-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012588   Gene: ENSGGOG00000012908   Transcript: ENSGGOT00000012951
Sequence length 177
Comment pep:known_by_projection chromosome:gorGor3.1:3:128983542:128985179:-1 gene:ENSGGOG00000012908 transcript:ENSGGOT00000012951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVWGALFLLWATAEATKDCPSPCTCRALETMGLWVDCRGHGLTALPALPARTRHLLLAN
NSLQSVPPGAFDHLPQLQTLDVTQNPWHCDCSLTYLRLWLEDRTPEALLQVRCASPSLAA
HGPLGRLTGYQLGSCGWQLQASWVRPGVLWDVALVAVAVLGLALLAGLLCATTEALD
Download sequence
Identical sequences G3RAV6
ENSGGOP00000012588 XP_004036316.1.27298 ENSGGOP00000012588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]