SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012597 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012597
Domain Number 1 Region: 349-522,556-720
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.48e-87
Family YicI catalytic domain-like 0.00068
Further Details:      
 
Domain Number 2 Region: 104-347
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.91e-40
Family YicI N-terminal domain-like 0.006
Further Details:      
 
Domain Number 3 Region: 723-819
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000000000288
Family Putative glucosidase YicI, domain 3 0.0073
Further Details:      
 
Domain Number 4 Region: 78-132
Classification Level Classification E-value
Superfamily Trefoil 0.0000000000785
Family Trefoil 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012597   Gene: ENSGGOG00000012906   Transcript: ENSGGOT00000012960
Sequence length 952
Comment pep:known_by_projection chromosome:gorGor3.1:5:3036398:3054727:-1 gene:ENSGGOG00000012906 transcript:ENSGGOT00000012960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVRHPPCSRRLLAVYALVSLATAALLGHILLHDFLRVPRELSGSSPVLEEAHPAHQQGA
SRPGPRDAQAHPGRPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYIPAKQGLRGA
QMGQPWCFFPPSYPSYKLENLSSSEMGYMATLTRTTPTFFPKDILTLRLDVMMETENRLH
FTIKDPANRRYEVPLETPRVHSRALSPLYSVEFSEEPFGVIVRRQLDGRVLLNTTVAPLF
FADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNRDLAPTPGANLYGSHPFYLA
LEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLEVVGY
PFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDG
FRDFPAMVQELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGKV
WPGSTAFPDFTNPTALAWWEDMVAEFHEQVPFDGMWIDMNEPSNFIRGSEDGCPNNELEN
PPYVPGVVGGTLQAATICASSHQFLSTHYNLHNLYGLTEAIASHRALVKARGTRPFVISR
STFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVR
WTQLGAFYPFMRNHNGLLNLPQEPYSFSKPAQQAMRKALTLRYALLPHLYTLFHQAHVAG
ETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGTWYDLQTVPI
EALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQP
MALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVRVTSEGAGLQ
LQKVTVLGVATAPQQVISNGVPVSNFTYSPDTKVLDIHVSLLMGEQFLISWS
Download sequence
Identical sequences ENSGGOP00000012597 ENSGGOP00000012597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]