SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012599 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012599
Domain Number 1 Region: 9-168
Classification Level Classification E-value
Superfamily DTD-like 2.09e-43
Family DTD-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012599   Gene: ENSGGOG00000012917   Transcript: ENSGGOT00000012962
Sequence length 168
Comment pep:novel chromosome:gorGor3.1:14:12597739:12607387:-1 gene:ENSGGOG00000012917 transcript:ENSGGOT00000012962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGSRIPQARALLQQCLHARLQIRPADGDVVAQWVEVQRGLVIYVCFFKGADKELLPKM
VNTLLNVKLSETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYS
QFVTLCEKEVAANSKCAEARVVVEHGTYGNRQVLKLDTNGPFTHLIEF
Download sequence
Identical sequences A0A2I2YZI5
ENSGGOP00000012599 XP_004055107.1.27298 ENSGGOP00000012599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]