SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012603 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012603
Domain Number 1 Region: 432-774
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 7.85e-56
Family Diacylglycerol kinase-like 0.016
Further Details:      
 
Domain Number 2 Region: 5-92,157-184
Classification Level Classification E-value
Superfamily EF-hand 1.47e-38
Family EF-hand modules in multidomain proteins 0.0057
Further Details:      
 
Domain Number 3 Region: 159-266
Classification Level Classification E-value
Superfamily EF-hand 2.52e-18
Family Calmodulin-like 0.026
Further Details:      
 
Domain Number 4 Region: 246-323
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000658
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0045
Further Details:      
 
Domain Number 5 Region: 328-385
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000166
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012603   Gene: ENSGGOG00000012909   Transcript: ENSGGOT00000012966
Sequence length 793
Comment pep:known_by_projection chromosome:gorGor3.1:3:187564280:187803953:-1 gene:ENSGGOG00000012909 transcript:ENSGGOT00000012966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMGEERWVSLTPEEFDQLQKYSEYSSKKIKDVLTEFNEGGSLKQYDPHEPISYDVFKLFM
RAYLEVDLPQPLSTHLFLAFSQKPRHETSDHPTEGASNSEANSADTNIQNADNATKADEA
CAPDTESNMAEKQAPTEDQVAATPLEPPVPRSSSSESPVVYLKDVVCYLSLLETGRPQDK
LEFMFRLYDSDENGLLDQAEMDCIVNQMLHIAQYLEWDPTELRPILKEMLQGMDYDRDGF
VSLQEWVHGGMTTIPLLVLLGMDDSGSKGDGRHSWTMKHFKKPTYCNFCHIMLMGVRKQG
LCCTYCKYTVHERCVSKNIPGCVKTYSKAKRSGEVMQHAWVEGNSSVKCDRCHKSIKCYQ
SVTAQHCVWCRMTFHRKCELSTLCDGGELRDHILLPTSICPITRDRPGEKSDGCVSAKGE
LVMQYKIIPTPGTHPLLVLVNPKSGGRQGESRILRKFHYLLNPKQVFNLDNGGPTPGLNF
FRDTPDFRVLACGGDGTVGWILDCIDKANFAKHPPVAVLPLGTGNDLARCLRWGGGYEGG
SLTKILKDIEQSPLVMLDRWHLEVIPREEVENGDQVPYSIMNNYFSIGVDASIAHRFHVM
REKHPEKFNSRMKNKLWYFEFGTSETFAATCKKLHDHIELECDGVGVDLSNIFLEGIAIL
NIPSMYGGTNLWGENKKNRAVIRESRKGVTDPKELKFCVQDLSDQLLEVVGLEGAMEMGQ
IYTGLKSAGRRLAQCSSVTIRTNKLLPMQVDGEPWMQPCCTIKITHKNQAPMMMGPPQKS
SFFSLRRKSRSKD
Download sequence
Identical sequences ENSGGOP00000012603 ENSGGOP00000012603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]