SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012609 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012609
Domain Number 1 Region: 55-95
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000134
Family EGF-type module 0.027
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000012609
Domain Number - Region: 236-458
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0101
Family Rhodopsin-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012609   Gene: ENSGGOG00000012921   Transcript: ENSGGOT00000012972
Sequence length 465
Comment pep:novel chromosome:gorGor3.1:19:7158545:7190471:-1 gene:ENSGGOG00000012921 transcript:ENSGGOT00000012972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPGLTVLLALPGSEAKNSGASCPPCPKYGSCHNSTHCTCEDGFRARSGRTYFPDSSEKCE
DINECETGLAKCKYKAYCRNKVGGYICSCLVKYTLFNFLAGIIDYDHPDCYENNSQGTTQ
SNVDIWENLRRNGSREDFARRATQLIQSVELSIWNASFASPGKGQISEFDIVYETKRCNE
TRENAFLEAGNNTMDINCADALKGTLRESTAVALSLINLLGILPIQNTSTSLHLELSLCL
FLAHLLFLTGINRTEPEVLCSIIAGLLHFLYLACFTWMLLEGLHLFLTVRNLKVANYTST
GRFKKRFMYPVGYGIPAVIIAVSAIVGPQNYGTFTHCWLKLDKGFIWSFMGPVAVIILIN
LVFYFQVLWILRSKLSSLNKEVSTIQDTRVMTFKAISQLFILGCSWGLGFFMVEEVGKTI
GSIIAYSFTIINTLQGVLLFVVHCLLNRQVRLITLSVISLVPKSN
Download sequence
Identical sequences ENSGGOP00000012609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]