SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012611 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012611
Domain Number 1 Region: 25-110
Classification Level Classification E-value
Superfamily PDZ domain-like 6.57e-16
Family PDZ domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012611   Gene: ENSGGOG00000012923   Transcript: ENSGGOT00000012974
Sequence length 1617
Comment pep:known_by_projection chromosome:gorGor3.1:X:9606346:9767538:1 gene:ENSGGOG00000012923 transcript:ENSGGOT00000012974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGAEPRARPERLAEAETRAADGGRLVEVQLSGGAPWGFTLKGGREHGEPLVITKIEEGS
KAAAVDKLLAGDEIVGINDIGLSGFRQEAICLVKGSHKTLKLVVKRRSELGWRPHSWHAT
KFSDSHPELAASPFTSTSGCPSWSGRHHASSSSHDLSSSWEQTNLQRTLDHFSSLGSVDS
LDHPSGRLSVAKSNSSIDHLGSHSKRDSAYGSFSTSSSTPDHTLSKADTSSAENILYTVG
LWEAPRQGGRQAQAAGDTQGSEEKLRCFPPRVPGDSGKGPRPEYNAEPKLAAPGRSNFGP
VWYVPDKKKVPSSPPPPPPPLRSDSFAATKSQEKAQGPVFSEAAAAQHFTALAQAQPRGD
RRPELTDRPWRSAHPGSLGKGSGGPGCPQEAHADGSWPPSKDGASSRLQASLSSSDVRFL
QSPHSGRHPPLYSDHSPLCADSLGQEPGAASFQNDSPPQVRGLSSCDQNLGSGWQGPRPC
VQGDLQAAQLWAGCWPSDTALGALESLPPPTVGQSPRHHLPQPEGPPDARETGRCYPLDT
GAKGCSMGAQEPPRASRAEKASQRLAASITWADGESSRICPQETPLLHSLTQEGRRRPES
SPEDSATRPPPFDAHVGKPTRRSDRFATTLRNEIQMHRAKLQKSRSTVALTAAGEAEDVT
GRWRAGLGGGTQEGPLAGTYKDHLKEAQARVLRATSFKRRDLDPNPGDLYPESLEHRMGD
PDAVPHFWEAGLAQPPSSTSGGPHPPRIGGRRRFTAEQKLKSYSEPEKMNEVGLTRGYSP
HQHPRTSEDTVGTFADRWKFFEETSKPVPQRPAQKQALHGIPRDKPERPRTAGRTCEGTE
PWSRTTSLGDSLNAHSAAEKAGTSDPPRRLGTFAEYQASWKEQRKPLEARSSGRCHSADD
ILDVSLDPQERPQHVHGRSRSSPSTDHYKQEASVELRRQAGEPGEPREELPSAVRAEEGQ
STPRQADAQCQEGSPGSQQHPPSQKAPNPPAFSELSHCRGAPELPREGRGRAGTLPRDYR
YSEESTPADLGPRAQSPGSPLHARGQDSWPVISALLSKKPAPQRPPPPKREPRRYRATDG
VPADAPLAVLGRPFPTPSPASLDVYVARLSLSHSPSVFSSAQPQDTPKATVCERGSQHVS
GDASRPLPEALLPPKQQHLRLQTATMETSRSPSPQFAPQKLTDKPPLLIQDEDSTRIERV
MDNNTTVKMVPIKIVHSESQPEKESRQSLACPAEPPALPHGLEKDQIKTLSTSEQFYSRF
CLYTXXXXXXXXXXXRAQPAEPQPLGTQVPPEKDRCASPPGLSYVKAKEKTVEDLKSEEL
AREIVGKDKSLADILDPSVKIKTTMDLMEGIFPKDEHLLEEAQQRRKLLPKIPSPRSTEE
RKEEASMPAAVSLATNSTYYSTSAPKAELLIKMKDLQEQQEHEEDSGSDLDHDLSVKKQE
LIESISRKLQVLREARESLLEDVQANTVLGAEVEAIVKGVCKPSEFDKFRMFIGDLDKVV
NLLLSLSGRLARVENALNNLDDGASPGDRQSLLEKQRVLIQQHEDAKELKENLDRREHIV
FDILANYLSEESLADYEHFVKMKSALIIEQRELEDKIHLGEEQLKCLFDSLQPERGK
Download sequence
Identical sequences ENSGGOP00000012611 ENSGGOP00000012611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]