SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012620 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012620
Domain Number 1 Region: 606-996
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 1.7e-103
Family Formin homology 2 domain (FH2 domain) 0.00000247
Further Details:      
 
Domain Number 2 Region: 63-427
Classification Level Classification E-value
Superfamily ARM repeat 6.58e-101
Family Diap1 N-terninal region-like 0.0000365
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000012620
Domain Number - Region: 447-524
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.00628
Family Methicillin resistance protein FemA probable tRNA-binding arm 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012620   Gene: ENSGGOG00000012922   Transcript: ENSGGOT00000012984
Sequence length 1071
Comment pep:known_by_projection chromosome:gorGor3.1:14:40082081:40257153:1 gene:ENSGGOG00000012922 transcript:ENSGGOT00000012984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHQEIEQNSAMAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPV
EELDVMFSELVDELDLTDKHREAMFALPAEKKWQIYCSKKKDQEENKGATSWPEFYIDQL
NSMAARKSLLALEKEEEEERSKTIESLKTALRTKPMRFVTRFIDLDGLSCILNFLKTMDY
ETSESRIHTSLIGCIKALMNNSQGRAHVLAHSESINVIAQSLSTENIKTKVAVLEILGAV
CLVPGGHKKVLQAMLHYQKYASERTRFQTLINDLDKSTGRYRDEVSLKTAIMSFINAVLS
QGAGVESLDFRLHLRYEFLMLGIQPVIDKLREHENSTLDRHLDFFEMLRNEDELEFAKRF
ELVHIDTKSATQMFELTRKRLTHSEAYPHFMSILHHCLQMPYKRSGNTVQYWLLLDRIIQ
QIVIQNDKGQDPDSTPLENFNIKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKE
RECDAKTQEKEEMMQTLNKMKEKLEKETTEHKQVKQQVADLTAQLHELSRRAVCASIPGG
PSPGAPGGPFPSSVPGSLLPPPPPPPLPGGTGPPPLGAIMPPPGAPMGLALKKKSIPQPT
NALKSFNWSKLPENKLEGTVWTEIDDTKVFKILDLEDLERTFSAYQRQQDFFVNSNSKQK
EADAIDDTLSSKLKVKELSVIDGRRAQNCNILLSRLKLSNDEIKRAILTMDEQEDLPKDM
LEQLLKFVPEKSDIDLLEEHKHELDRMAKADRFLFEMSRINHYQQRLQSLYFKKKFAERV
AEVKPKVEAIRSGSEEVFRSGALKQLLEVVLAFGNYMNKGQRGNAYGFKISSLNKIADTK
SSIDKNITLLHYLITIVENKYPSVLNLNEELRDIPQAAKVNMTELDKEISTLRSGLKAVE
TELEYQKSQPPQPGDKFVSVVSQFITVASFSFSDVEDLLAEAKDLFTKAVKHFGEEAGKI
QPDEFFGIFDQFLQAVSEAKQENENMRKKKEEEERRARMEAQLKEQRERERKMRKAKENS
EESGEFDDLVSALRSGEVFDKDLSKLKRNRKRITNQMTDSSRERPITKLNF
Download sequence
Identical sequences ENSGGOP00000012620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]