SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012638 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012638
Domain Number 1 Region: 52-112
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000017
Family HLH, helix-loop-helix DNA-binding domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012638   Gene: ENSGGOG00000012953   Transcript: ENSGGOT00000013002
Sequence length 330
Comment pep:known_by_projection chromosome:gorGor3.1:7:133460089:133491343:1 gene:ENSGGOG00000012953 transcript:ENSGGOT00000013002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKIDVDKIVFFNQEIRLWQLIMATPEENSNPHDRATPQLPAQLQELEHRVARRRLSQAR
HRATLAALFNNLRKTVYSQSDLIASKWQVLNKAKSHIPELEQTLDNLLKLKASFNLEDGH
ASSLEEVKKEYASMYSGNDSFPQNGSSPWYLNFYKQTMDLLTGSGIITPQEAALPIVSAA
ISHLWQNLSEERKASLRQAWAQKHRGPATLAEACREPACAEGSVKDSGVDSQGASCSLVS
TPEEILFEDAFDVASFLDKSEVPSTSSSSSVLASCNPENPEEKFQLYMQIINFFKGLSCA
NTQVKQEASFPVDEEMIMLQCTETFDDEDL
Download sequence
Identical sequences G3RB03
XP_004046321.1.27298 ENSGGOP00000012638 ENSGGOP00000019330 ENSGGOP00000012638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]