SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012674 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012674
Domain Number 1 Region: 40-515
Classification Level Classification E-value
Superfamily Sema domain 6.93e-158
Family Sema domain 0.0000000000000115
Further Details:      
 
Domain Number 2 Region: 1097-1359
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-79
Family Protein kinases, catalytic subunit 0.000000000134
Further Details:      
 
Domain Number 3 Region: 654-728
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000323
Family E-set domains of sugar-utilizing enzymes 0.034
Further Details:      
 
Domain Number 4 Region: 561-657
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000458
Family Other IPT/TIG domains 0.056
Further Details:      
 
Domain Number 5 Region: 517-563
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000139
Family Plexin repeat 0.0000401
Further Details:      
 
Domain Number 6 Region: 774-843
Classification Level Classification E-value
Superfamily E set domains 0.00000268
Family Other IPT/TIG domains 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012674   Gene: ENSGGOG00000012982   Transcript: ENSGGOT00000013040
Sequence length 1408
Comment pep:known chromosome:gorGor3.1:7:114559611:114684658:1 gene:ENSGGOG00000012982 transcript:ENSGGOT00000013040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEH
HIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGIWKDNINMAL
VVDTYYDDQLISCGSVNRGTCQRHVFPHNHTVDIQSEVHCIFSPQIEEPSQCPDCVVSAL
GAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPE
FRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECIL
TEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRS
AMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEF
TTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFL
LDSHPVSPEVIVEHTLNQNGYTLVVTGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGW
CHDKCVRSEECLSGTWTQQICLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKK
TRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVDPVIT
SISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEF
AVKLRIDLANRETSIFSYREDPIVYEIHPTKSFISTWWKEPLNIVSFLFCFASGGSTITG
VGKNLNSVSVPRMVINVHEAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFM
LDGILSKYFDLIYVHNPVFKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSC
ENIHLHSEAVLCTVPNDLLKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSIS
TALLLLLGFFLWLKKRKQIKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVD
YRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPEL
VQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVS
QFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLI
GFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTG
AKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRL
LQPEYCPDPLYEVMLKCWHPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCV
APYPSLLSSEDNADDEVDTRPASFWETS
Download sequence
Identical sequences ENSGGOP00000012674 ENSGGOP00000012674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]