SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012741 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012741
Domain Number 1 Region: 125-321
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.98e-41
Family DnaQ-like 3'-5' exonuclease 0.00000000318
Further Details:      
 
Domain Number 2 Region: 76-112
Classification Level Classification E-value
Superfamily SAP domain 0.0000961
Family SAP domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012741   Gene: ENSGGOG00000013059   Transcript: ENSGGOT00000013108
Sequence length 349
Comment pep:known_by_projection chromosome:gorGor3.1:8:8601004:8631641:1 gene:ENSGGOG00000013059 transcript:ENSGGOT00000013108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDPQSKEPAGEAVAPALLESPRPEGGEEPPRPSTEETQQCKFDGRETKGSKFITSSASD
FSDPVYKEIAITNGCINRMSKEELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKES
NCADGYYDYICIIDFEATCEEGNPPEFVHEIIEFPVVLLNTHTLEIEDTFQQYVRPEINT
QLSDFCISLTGITQDQVDRADTFPQVLKKVIDWMKLKELGTKYKYSLLTDGSWDMSKFLN
IQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTIMLEKLGMDYDGRPHCGLDDSK
NIARIAVRMLQDGCELRINEKMHAGQLMSVSSSLPIEGTPPPQMPHSRK
Download sequence
Identical sequences G3RBA0
XP_018888429.1.27298 ENSGGOP00000012741 ENSGGOP00000012741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]