SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012752 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012752
Domain Number 1 Region: 447-502
Classification Level Classification E-value
Superfamily CCCH zinc finger 2.22e-21
Family CCCH zinc finger 0.000029
Further Details:      
 
Domain Number 2 Region: 419-445
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000089
Family CCCH zinc finger 0.00041
Further Details:      
 
Domain Number 3 Region: 391-416
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000981
Family CCCH zinc finger 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012752   Gene: ENSGGOG00000013071   Transcript: ENSGGOT00000013119
Sequence length 1293
Comment pep:known_by_projection chromosome:gorGor3.1:19:44302144:44350770:-1 gene:ENSGGOG00000013071 transcript:ENSGGOT00000013119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARPALITPNHPPVSVSPGPYEGPAPSTPSPPPCSPDARPATPHLLHHRLPLPDDREDGEL
EEGELEDDGAEETQDTSGGPERSRKEKGEKHHSDSDEEKSHRRLKRKRKKEREKEKRRSK
KRRKSKHKRHASSSDDFSDFSDDSDFSPSEKGHRKYREYSPPYAPSHQQYPPSHATPLPK
KAYSKMDSKSYGMYEDYENEQYGEYEGDEEEDMGKEDYDDFTKELNQYRRAKEGSSRGRG
SRGRGRGYRGRGSRGGSRGRGMGRGSRGRGRGSMGGDHPEDEEDFYEEEMDYGESEEPMG
DDDYDEYSKELNQYRRSKDSRGRGLSRGRGRGSRGRGKGMGRGRGRGGSRGGMNKGGMND
DEDFYDEDMGDGGGGSYRSRDHDKPHQQSDKKGKVICKYFVEGRCTWGDHCNFSHDIELP
KKRELCKFYITGFCARAENCPYMHGDFPCKLYHTTGNCINGDDCMFSHDPLTEETRELLD
KMLADDAEAGAEDEKEVEELKKQGINPLPKPPPGVGLLPTPPRPPGPQAPTSPNGRPMQG
APGPPQMPMPVHEPLSPQQLQQQDMYNKKIPSLFEIVVRPTGQLAEKLGVRFPGPGGPPG
PMGPGPNMGPPGPMGGPMHPDMHPDMHPDMHPDMHPDMHPDMPMGPGMNPGPPMGPGGPP
MMPYGPGDSPHSGMMPPIPPAQNFYENFYQQQEGMEMEPGLLGDAEDYGHYEELPGEPGE
HLFPEHPLEPDSFSEGGPPGRPKPGAGVPDFLPSAQRALYLRIQQKQQEEEERARRLAES
SKQDRENEEGDTGNWYSSDEDEGGSSVTSILKTLRQQTSSRPPASVGELSSSGLGDPRLQ
KGHPTGSRLADPRLSRDPRLTRHVEASGGSGPGDSGPSDPRLARALPTSKPEGSLHSSPV
GPSSSKGSGPPPTEEEEGERALREKAVNIPLDPLPGHPLRDPRSQLQQFSHIKKDVTLSK
PSFARTVLWNPEDLIPLPVPKQDVVPPVPAALQSMPTLDPRLHRAATAGPPNARQRPGAS
TDSSTQGANLPDFELLSRILKTVNATGSSAAPGSSDKPSDPRVRKAPTDPRLQKPTDSTA
SSRAAKPGPAEAPSPTASPSGDASPPATAPYDPRVLAAGGLGQGGGGGQSSVLSGISLYD
PRTPNAGGKATEPAADTGAQPKGAEGNGKSSASKAKEPPFVRKSALEQPETGKAGADGGT
PTDRYNSYNRPRPKAAAAPAATTATPPPEGAPPQPGVHNLPVPTLFGTVKQTPKTGSGSP
FAGNSPAREGEQDAASLKDVFKGFDPTASPFCQ
Download sequence
Identical sequences ENSGGOP00000012752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]