SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012753 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012753
Domain Number 1 Region: 6-91
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-20
Family PDZ domain 0.0000454
Further Details:      
 
Domain Number 2 Region: 640-704
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.2e-18
Family LIM domain 0.0092
Further Details:      
 
Domain Number 3 Region: 581-644
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.06e-18
Family LIM domain 0.0099
Further Details:      
 
Domain Number 4 Region: 548-579
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000143
Family LIM domain 0.0015
Further Details:      
 
Domain Number 5 Region: 700-724
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000222
Family LIM domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012753   Gene: ENSGGOG00000013070   Transcript: ENSGGOT00000013120
Sequence length 731
Comment pep:known_by_projection chromosome:gorGor3.1:10:99661713:99726563:1 gene:ENSGGOG00000013070 transcript:ENSGGOT00000013120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYSVTLTGPGPWGFRLQGGKDFNMPLTISRITPGSKAAQSQLSQGDLVVAIDGVNTDTM
THLEAQNKIKSASYNLSLTLQKSKRPIPISTTAPPVQTPLPVIPHQKDPDLDTNGSLVAP
SPSPEARASPGTPGTPELRPTFSPAFSRPSAFSSLAEASDPGPPRASLRAKTSPEGAWDL
LGPKALPGSSQPRQYNNPIGLYSAETLREMALMYQMSLRGKASGVGLPGGSLPIKDLAVD
STSPVYQAVIKSQNKPEDEADEWARRSSNLQSRSFRILAQMTGTEFMQDPDEEALRRSRS
RLISTPIEHAPVCTSQATTPLLPASAQPPAAASPSAASPPLATAAAHTAIASASTTAPAS
SPADSPRPQASSYSPAVAASSAPATHTSYSEGPAAPAPKPRVVTTASIRPSVYQPGRADI
NSFLPRAGAGLPPPPSPGGPAAKRSPGAAGRRPLPASTYSPSPGANYSPAPNYNPAPSVV
YSGGPAEPASRPPWVTDDSFSQKFAPGKSTTSISKQTLPRGGPAYTPAGPQVPPLARGTV
QRAERFPASSRTPLCGHCNNVIRGPFLVAMGRSWHPEEFTCAYCKTSLADVCFVEEQNNV
YCERCYEQFFAPLCAKCNTKIMGEVMHALRQTWHTTCFVCAACKKPFGNSLFHMEDGEPY
CEKDYINLFSTKCHGCDFPVEAGDKFIEALGHTWHDTCFICAVCHVNLEGQPFYSKKDRP
LCKKHAHTINL
Download sequence
Identical sequences ENSGGOP00000012753 ENSGGOP00000012753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]