SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012774 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012774
Domain Number 1 Region: 240-339
Classification Level Classification E-value
Superfamily C-type lectin-like 3.15e-29
Family C-type lectin domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012774   Gene: ENSGGOG00000013092   Transcript: ENSGGOT00000013143
Sequence length 341
Comment pep:known_by_projection chromosome:gorGor3.1:19:14856587:14881582:1 gene:ENSGGOG00000013092 transcript:ENSGGOT00000013143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHNLYSITGYPDPPGTMEEEEEDDDYENSTPPYKDLPPKPGTMEEEEEDDDYENSTPPYK
DLPPKPGTVEEEEEDDDYENSTPPYKDLPPKPGSSAPPRPPRAAKETEKPPLPCKPRNMT
GLDLAAVTCPPPQLAVNLEPSPLQPSLAATPVPWLNQRSGGPGCCQKRWMVYLCLLVVTS
LFLGCLGLTVTLIKYQELMEELRMLSFQQMTWRTNMTGMAGLAGLKHDIDRVRADTNQSL
VELWGLLDCRRITCPEGWLPFEGKCYYFSPSTKSWDEARMFCQENYSHLVIINSFAEHFW
EPEEPNNIHDEDCATMNKGGTWNDLSCYKTTYWICERKCSC
Download sequence
Identical sequences G3RBD1
ENSGGOP00000012774 ENSGGOP00000012774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]