SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012785 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012785
Domain Number 1 Region: 115-363
Classification Level Classification E-value
Superfamily PA domain 3.53e-79
Family PA domain 0.000000000958
Further Details:      
 
Domain Number 2 Region: 61-108,345-596
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.7e-78
Family FolH catalytic domain-like 0.000000000862
Further Details:      
 
Domain Number 3 Region: 598-669
Classification Level Classification E-value
Superfamily Transferrin receptor-like dimerisation domain 0.00000000000353
Family Transferrin receptor-like dimerisation domain 0.0000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012785   Gene: ENSGGOG00000001783   Transcript: ENSGGOT00000013154
Sequence length 669
Comment pep:known_by_projection chromosome:gorGor3.1:11:49860208:49938429:-1 gene:ENSGGOG00000001783 transcript:ENSGGOT00000013154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKA
FLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYP
NKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYA
RTEDFFKLERDMKINCSGKIVIARYGKIFRGNKVKNAQLAGAKGVILYSDPADYFAPGVK
SYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRHGIAEAVGLPSIPVHPIGYY
DAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQFCIRKVKMHIHSTNEVTRIY
NVIGTLRGAVEPDRYVILGGHRDSWVFGSIDPQSGAAVVRETVRSFGTLKKEGWRPRRTI
LFASWDAEEFGLLGSTEWAEENSRLLQECGVAYINADSSIEGNYTLRVDCTPLMYSLVYN
LTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRAR
YTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFD
CRYYAVVLRKYADKIYNISMKHPQEMKTYSVSFDSLFSAVKNFTEISSKFSERLQDFDKS
KPLILEMLN
Download sequence
Identical sequences ENSGGOP00000001757 ENSGGOP00000012785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]