SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012818 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012818
Domain Number 1 Region: 177-430
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.14e-55
Family Voltage-gated potassium channels 0.00083
Further Details:      
 
Domain Number 2 Region: 8-106
Classification Level Classification E-value
Superfamily POZ domain 1.05e-30
Family Tetramerization domain of potassium channels 0.0000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012818   Gene: ENSGGOG00000013142   Transcript: ENSGGOT00000013187
Sequence length 607
Comment pep:known_by_projection chromosome:gorGor3.1:1:113134440:113151700:1 gene:ENSGGOG00000013142 transcript:ENSGGOT00000013187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKGEASEKIIINVGGTRHETYRSTLRTLPGTRLAWLADPDGGGRPEEFFFDRHPGVFAY
VLNYYRTGKLHCPADVCGPLFEEELTFWGIDETDVEPCCWMTYRQHRDAEEALDIFESPD
GGGSGAGPSDEAGDDERELALQRLGPHEGGAGHGAGSGGCRGWQPRMWALFEDPYSSRAA
RVVAFASLFFILVSITTFCLETHEAFNIDGNVTEILRVGNITSVHFRREVETEPILTYIE
GVCVLWFTLEFLVRIVCCPDTLDFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGF
LRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERI
GARPSDPRGNDHTDFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIA
MPVPVIVNNFGMYYSLAMAKQKLPKKRKKHVPRPAQLESPMYCKSEETSPRDSTYSDTSH
TAREEGMIERKRADSKQNGDANAVLSDEEGAGLTQPLASSPTPEERRALRRSTTRDRNKK
AAACFLLSAGDYACADGSVRKGCGKSRSLNNIVGAAGTSLGLSPLALRYSSPYPLKKFLL
TPFHPLT
Download sequence
Identical sequences ENSGGOP00000012818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]