SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012848 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012848
Domain Number 1 Region: 47-133
Classification Level Classification E-value
Superfamily Cystatin/monellin 1.82e-22
Family Cystatins 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012848   Gene: ENSGGOG00000013172   Transcript: ENSGGOT00000013219
Sequence length 144
Comment pep:known_by_projection chromosome:gorGor3.1:20:24053177:24059083:1 gene:ENSGGOG00000013172 transcript:ENSGGOT00000013219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIGCWRNPLLLLIALVLSAKLGHFQRWEGFQQKPMSKKNMNSTLNFIQSYNNASNDTYL
YRVQKLIRSQMQLTTGVEYIVTVKIGWTKCKRNDMSNSSCPLQSKKLRKSLICESLIYTV
PWINYFQLWNNSCLDAEHVGRNLG
Download sequence
Identical sequences G3RBJ2
ENSGGOP00000012848 XP_004061948.1.27298 ENSGGOP00000012848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]