SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012874 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012874
Domain Number 1 Region: 218-311
Classification Level Classification E-value
Superfamily Immunoglobulin 6.03e-21
Family I set domains 0.0097
Further Details:      
 
Domain Number 2 Region: 135-225
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-16
Family I set domains 0.021
Further Details:      
 
Domain Number 3 Region: 55-139
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000107
Family I set domains 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012874   Gene: ENSGGOG00000013197   Transcript: ENSGGOT00000013245
Sequence length 355
Comment pep:known_by_projection chromosome:gorGor3.1:11:130253724:130685625:1 gene:ENSGGOG00000013197 transcript:ENSGGOT00000013245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVCGYLFLPWKCLVVVSLRLLFLVPTGVPVRSGDATFPKECSPKPLTYLSGLPFRCTID
NRVTRVAWLNRSTILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTD
NHPKTSRVHLIVQVSPKIVEISSDISINEGNNISLTCIATGRPEPTVTWRHISPKAVGFV
SEDEYLEIQGITREQSGDYECSASNDVAAPVVRRVKVTVNYPPYISEAKGTGVPVGQKGT
LQCEASAVPSAEFQWYKDDKRLIEGKKGVKVENRPFLSKLIFFNVSEHDYGNYTCVASNK
LGHTNASIMLFEVKTTALTPWKGPGAVSEVSNSTSRRAGCVWLLPLLVLHLLLKF
Download sequence
Identical sequences ENSGGOP00000012874 ENSGGOP00000012874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]