SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012878 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012878
Domain Number 1 Region: 25-150
Classification Level Classification E-value
Superfamily PIN domain-like 1.06e-23
Family PIN domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012878   Gene: ENSGGOG00000013203   Transcript: ENSGGOT00000013249
Sequence length 249
Comment pep:known_by_projection chromosome:gorGor3.1:8:116225501:116230966:1 gene:ENSGGOG00000013203 transcript:ENSGGOT00000013249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKITRQKHAKKHLGFFRNNFGVREPYQILLDGTFCQAALRGRIQLREQLPRYLMGETQLC
TTRCVLKELETLGKDLYGAKLIAQKCQVRNCPHFKNAVSGSECLLSMVEEGNPHHYFVAT
QDQNLSVKVKKKPGVPLMFIIQNTMVLDKPSPKTIAFVKAVESGQLVSVHEKESIRHLKE
EQGLVKNTEQSRRKKRKKISGPNPLSCLKKKKKAPDTQSSASEKKRKRKRIRNRSNSKVL
SEKQNAEGE
Download sequence
Identical sequences A0A2I2YP15
XP_004047506.1.27298 ENSGGOP00000012878 ENSGGOP00000012878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]