SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012923 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012923
Domain Number 1 Region: 1-208,272-334
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.41e-32
Family D-aminoacid oxidase, N-terminal domain 0.0000000232
Further Details:      
 
Domain Number 2 Region: 195-287
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 5.49e-24
Family D-aminoacid oxidase-like 0.00000571
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012923   Gene: ENSGGOG00000013247   Transcript: ENSGGOT00000013295
Sequence length 347
Comment pep:known_by_projection chromosome:gorGor3.1:12:108375741:108396705:1 gene:ENSGGOG00000013247 transcript:ENSGGOT00000013295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVVVIGAGVIGLSTALCIHERYHSVLQPLDVKVYADRFTPLTTTDVAAGLWQPYLSDPN
NPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPR
ELDMFPDYGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGTDVIVN
CTGVWAGALQPDPLLQPGRGQIIKVDAPWMKHFILTHDPERGIYNSPYIIPGTQTVTLGG
IFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERTGLRPVRPQIRLEREQLRTGP
SNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEEKKLSRMPPSHL
Download sequence
Identical sequences G3RBQ9
ENSGGOP00000012923 XP_004053897.1.27298 XP_018894610.1.27298 ENSGGOP00000012923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]