SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012925 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012925
Domain Number 1 Region: 3909-4100
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.17e-39
Family Laminin G-like module 0.00065
Further Details:      
 
Domain Number 2 Region: 4163-4365
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.47e-37
Family Laminin G-like module 0.00065
Further Details:      
 
Domain Number 3 Region: 3638-3847
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.06e-33
Family Laminin G-like module 0.001
Further Details:      
 
Domain Number 4 Region: 403-488
Classification Level Classification E-value
Superfamily Immunoglobulin 3.81e-21
Family I set domains 0.008
Further Details:      
 
Domain Number 5 Region: 1955-2043
Classification Level Classification E-value
Superfamily Immunoglobulin 2.4e-19
Family I set domains 0.017
Further Details:      
 
Domain Number 6 Region: 3298-3387
Classification Level Classification E-value
Superfamily Immunoglobulin 2.8e-19
Family I set domains 0.013
Further Details:      
 
Domain Number 7 Region: 3572-3660
Classification Level Classification E-value
Superfamily Immunoglobulin 3.28e-19
Family I set domains 0.011
Further Details:      
 
Domain Number 8 Region: 3211-3303
Classification Level Classification E-value
Superfamily Immunoglobulin 5.89e-19
Family I set domains 0.0076
Further Details:      
 
Domain Number 9 Region: 2050-2136
Classification Level Classification E-value
Superfamily Immunoglobulin 1.14e-18
Family I set domains 0.037
Further Details:      
 
Domain Number 10 Region: 1676-1771
Classification Level Classification E-value
Superfamily Immunoglobulin 5.92e-18
Family I set domains 0.015
Further Details:      
 
Domain Number 11 Region: 3495-3578
Classification Level Classification E-value
Superfamily Immunoglobulin 6.39e-17
Family I set domains 0.014
Further Details:      
 
Domain Number 12 Region: 3108-3202
Classification Level Classification E-value
Superfamily Immunoglobulin 9.06e-17
Family I set domains 0.035
Further Details:      
 
Domain Number 13 Region: 1772-1859
Classification Level Classification E-value
Superfamily Immunoglobulin 1.69e-16
Family I set domains 0.0000262
Further Details:      
 
Domain Number 14 Region: 3022-3117
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-16
Family I set domains 0.031
Further Details:      
 
Domain Number 15 Region: 2537-2621
Classification Level Classification E-value
Superfamily Immunoglobulin 8.81e-16
Family I set domains 0.019
Further Details:      
 
Domain Number 16 Region: 2730-2816
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000014
Family I set domains 0.054
Further Details:      
 
Domain Number 17 Region: 2628-2715
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000018
Family I set domains 0.016
Further Details:      
 
Domain Number 18 Region: 2435-2522
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000225
Family I set domains 0.048
Further Details:      
 
Domain Number 19 Region: 2245-2326
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000025
Family I set domains 0.057
Further Details:      
 
Domain Number 20 Region: 2924-3009
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000365
Family I set domains 0.072
Further Details:      
 
Domain Number 21 Region: 1864-1955
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000366
Family I set domains 0.04
Further Details:      
 
Domain Number 22 Region: 3400-3491
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000513
Family I set domains 0.024
Further Details:      
 
Domain Number 23 Region: 2154-2238
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000109
Family I set domains 0.065
Further Details:      
 
Domain Number 24 Region: 2826-2912
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000124
Family I set domains 0.035
Further Details:      
 
Domain Number 25 Region: 2343-2429
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000117
Family I set domains 0.08
Further Details:      
 
Domain Number 26 Region: 320-358
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000537
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 27 Region: 1563-1615
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000586
Family Laminin-type module 0.0087
Further Details:      
 
Domain Number 28 Region: 365-408
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 29 Region: 280-317
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000916
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 30 Region: 763-815
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000012
Family Laminin-type module 0.0047
Further Details:      
 
Domain Number 31 Region: 1159-1211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000067
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 32 Region: 823-871
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000991
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 33 Region: 3841-3882
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000288
Family EGF-type module 0.015
Further Details:      
 
Domain Number 34 Region: 196-234
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000103
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 35 Region: 1219-1264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000128
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 36 Region: 4105-4148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000157
Family EGF-type module 0.012
Further Details:      
 
Domain Number 37 Region: 1622-1670
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000494
Family Laminin-type module 0.046
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000012925
Domain Number - Region: 886-925
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000377
Family Laminin-type module 0.029
Further Details:      
 
Domain Number - Region: 1275-1322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family Laminin-type module 0.0072
Further Details:      
 
Domain Number - Region: 1122-1161
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00204
Family Laminin-type module 0.092
Further Details:      
 
Domain Number - Region: 1528-1565
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00419
Family EGF-type module 0.091
Further Details:      
 
Domain Number - Region: 725-765
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0184
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012925   Gene: ENSGGOG00000013212   Transcript: ENSGGOT00000013297
Sequence length 4391
Comment pep:known_by_projection chromosome:gorGor3.1:1:22538085:22615394:-1 gene:ENSGGOG00000013212 transcript:ENSGGOT00000013297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQWEIERVTQSALVCLQVTHGLRAYDGLSLPEDIETVTASQMRWTHSYLSDDEDMLADSI
SGDDLGSGDLGSGDFQMVYFRALVNFTRSIEYSPQLEDAGSREFREVSEAVVDTLESEYL
KIPGDQVVSVVFIKELDGWVFVELDVGSEGNVDGAQIQEVLLRVISSGSMASYITSPQGF
QFRRLGTAAVPQFPRACTEAEFACHSYNECVALEYRCDRRPDCRDMSDELNCEEPVLGIS
PTFSLLMETTPLPPRPETTIMRQPPVTHAPQPLLPGSVRPLPCGPQEAACRSGHCIPRDY
LCDGQEDCEDGSDELDCGPPPPCEPNEFPCGNGHCALKLWRCDGDFDCEDRTDEANCPTK
RPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRESIQASRGQ
TVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTSEGGRGTLIIRDVKESDQGAYTCEAM
NARGMVFGIPDGVLELVPQRAGPCPDGHFYLEHSAACLPCFCFGITSVCQSTRRFRDQIR
LRFDQPDDFKGVNVTMPAQPGTPPLSSTQLQIDPSLHEFQLVDLSRRFLVHDSFWALPEQ
FLGNKVDSYGGSLRYNVRYELARGMLEPVQRPDVVLVGAGYRLLSRGHTPTQPGALNQRQ
VQFSEEHWVHESGRPVQRTELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHATS
HGRAHSVEECRCPIGYSGLSCESCDAHFTRVPGGPYLGTCSGCNCNGHASSCDPVYGHCL
NCQHNTEGPQCNKCKAGFFGDAMKATATACRPCPCPYIDASRRFSDTCFLDTDGQATCDA
CAPGYTGRRCESCAPGYEGNPIQPGGKCRPVNQEIVRCDERGSMGTSGEACRCKNNVVGR
LCNECADGSFHLSTRNPDGCLKCFCMGVSRHCTSSSWSRAQVHGASEEPGHFSLTNAAST
HTTTEGIFSPTPGELGFSSFHRLLSGPYFWSLPSRFLGDKVVTSYGGELRFTVTQRSQPG
STPLHGQPLVVLQGNNIILEHHVAQEPSPGQPSTFTVPFREQAWQRPDGQPATREHLLMA
LAGIDTLLIRASYAQQPTESRVSGISMDVAVPEETGQDPALEVEQCSCPPGYRGPSCQDC
DTGYTRTPSGLYLGTCERCSCHGHSEACEPETGACQGCQHHTEGPQCERCQPGYYGDAQR
GTPQDCQLCPCYGDPAAGQAAHTCFLDTDGHPTCDTCSPGHSGRHCERCAPGYYGNPSQG
QPCQRDSQVPGPIGCNCDPQGSVSSRCDAAGQCQCKAQVEGLTCSHCRPHHFHLSASNPD
GCLPCFCMGITQQCTSSAYTRHLISTHFAPGDFQGFALVNPQRNSRLTGEFTVEPVPEGA
QLSFGNFAQLGHESFYWQLPETYQGDKVAAYGGKLRYTLSYTAGPQGSPLSDPDVQITGN
NIMLVASQPALQGPERRSYEIVFREEFWRRPDGQPATREHLLMALADLDELLIRATFSSV
PLAASISAVSLEVAQPGPSNGPRALEVEECRCPPGYIGLSCQDCAPGYTRTGSGLYLGHC
ELCECNGHSDLCHPETGACSQCQHNAAGEFCELCAPGYYGDATAGTPEDCQPCACPLTNP
ENMFSRTCESLGAGGYRCTACEPGYTGQYCEQCGPGYVGNPSVQGGRCLPETNQAPLVVE
VHPARSIVPQGGSHSLRCQVSGSPPHYFYWSREDGRPVPSGTQQRHQGSELHFPSVQPSD
AGVYICTCRNLHQSNTSRAELLVTEAPSKPITVTVEEQRSQSVRPGADVTFICTAKSKSP
AYTLVWTRLHNGKLPTRAMDFNGILTIRNVQLSDAGTYVCTGSNMFAMDQGTATLHVQAS
GTLSAPVVSIHPPQLTVQPGQLAEFRCSATGSPTPTLEWTGGPGGQLPAKAQIHGGILRL
PAVEPTDQAQYLCRAHSSAGQQVARAVLHVHGGGGPRVQVSPERTQVHEGRTVRLYCRAA
GVPSATITWRKEGGSLPPQARSERTDIATLLIPAITTADAGFYLCVATSPAGTAQARIQV
VVLSASDASPPPVKIESSSPSVTEGQTLDLNCVVAGSAHAQVTWYRRGGSLPPHTQVHGS
RLRLPQVSPADSGEYVCRVENGSGPKEASITVSVLHGTHSGPSYTPVPGSTQPIRIEPSS
SHVAEGQTLDLNCVVPGQAHAQVTWHKRGGSLPARHQTHGSLLRLYQVTPADSGEYVCRV
LGTSGPLEASVLVTIEASVIPGPIPPVRIESSSSTVAEGQTLDLSCVVAGQAHAQVTWYK
RGGSLPARHQVRGSRLYIFQASPADAGQYVCRASNGMEASITVTVTGTQGANLAYPAGST
QPIRIEPSSSQVAEGQTLDLNCVVPGQSHAQVTWHKRGGSLPVRHQTHGSLLRLYQVSPA
DSGEYVCRVLGSSVPLEASVLVTIEPAGSVPALGVTPTVRIESSSSHVAEGQTLDLNCLV
AGQAHAQVTWHKRGGSLPAWHQVHGSRLRLLQVTPADSGEYVCRVVGSSGTQEASVLVTI
QQRLSGSHSQGVAYPVRIESSSASLANGHTLDLNCLVASQAPHTITWYKRGGSLPSRHQI
VGSRLRIPQVTPADSGEYVCHVSNGAGSRETSLIVTIQGSGSSHVPSVSPPIRIESSSPV
VVEGQTLDLNCVVARQPQAIITWYKRGGSLPSRHQTHGSHLRLHQMSVADSGEYVCRANN
NIDALEASIVISVSPGAGSPSAPGSSMPIRIESSSSHVAEGQTLDLNCVVPGQAHAQVTW
HKRGGSLPSHHQTHGSRLRLHQVSPADSGEYVCRVMGSSGPLEASVLVTIEASGSSAVHV
PAPGGAPPIRIETSSSRVAEGQTLDLKCVVPGQAHAQVTWHKRGGNLPARHQVHGPLLRL
NQVSPADSGEYSCQVTGSSGTLEASVLVTIEPSSPGPIPAPGLAQPIYIEASSSHVTEGQ
TLDLNCVVPGQAHAQVTWYKRGGSLPARHQTHGSQLRLHHVSPADSGEYVCRAAGGPGPE
QEASFTVTVPPSEGSSYRLRSPVISIDPPSSTVQQGQDASFKCLIHDGAAPISLEWKTRN
QELEDNVHISPNGSIITIVGTRPSNHGTYRCVASNAYGVAQSVVNLSVHGPPTVSVLPEG
PVWVKVGKAVTLECVSAGEPRSSARWTRISSTPAKLEQRTYGLMDSHAVLQISSAKPSDA
GTYVCLAQNALGTAQKQVEVIVDTGAMAPGAPQVQAEEAELTVEAGHTATLRCSATGSPA
PTIHWSKLRSPLPWQHRLEGDTLIIPRVAQQDSGQYICNATSPAGHAEATIILHVESPPY
ATTVPEHASVQAGETVQLQCLAHGTPPLTFQWSRVGSSLPGRATARNELLHFERAAPEDS
GRYRCRVTNKVGSAEAFAQLLVQGPPGSLPATSIPAGSTPTVQVTPQLETKSIGASVEFH
CAVPGDRGTQLRWFKEGGQLPPGHSVQDGVLRIQNLDQSCQGTYICQAHGPWGKAQASAQ
LVVQALPSVLINIRTSVQTVVVGHAVEFECLALGDPKPQVTWSKVGGHLRPGIVQSGGVV
RIAHVELADAGQYRCTATNAAGTTQSHVLLLVQALPQISMPQEVRVPAGSAAVFPCIASG
YPTPDISWSKLDGSLPPDSRLENNMLMLPSVRPQDAGTYVCTATNRQGKVKAFAHLQVPE
RVVPYFTQTPYSFLPLPTIKDAYRKFEIKITFRPDSADGMLLYNGQMRVPGSPTNLANRQ
PDFISFGLVGGRPEFRFDAGSGMATIRHPTPLALGHFHTVTLLRSLTQGSLIVGDLAPVN
GTSQGKFQGLDLNEELYLGGYPDYGAIPKAGLSGGFIGCVRELRIQGEEIVFHDLNLTAH
GISHCPTCRDRPCQNGGQCHDSESSSYVCVCPAGFTGSRCEHSQALHCHPEACGPDATCV
NRPDGRGYTCRCHLGRSGLRCEEGVTVTTPSLSGAGSYLALPALTNTHHELRLDVEFKPL
APDGVLLFSGGKSGPVEDFVSLAMVGGHLEFRYELGSGLAVLRSAEPLALGRWHRVSAER
LNKDGSLRVNGGRPVLRSSPGKSQGLNLHTLLYLGGVEPSVPLSPATNTSAHFRGCVGEV
SVNGKRLDLTYSFLGSQGIGQCYDSSPCERQPCQHGATCMPAGEYEFQCLCRDGFKGDLC
EHEENPCQLREPCLHGGTCQGTRCLCLPGFSGPRCQQGSGHGIAESDWHLEGSGGNDAPG
QYGAYFHDDGFLAFPGRVFSRSLPEVPETIELEVRTSTANGLLLWQGVEVGEAGRGKDFI
SLGLQDGHLVFRYQLGSGEARLVSEDPINDGEWHRVTALREGRRGSIQVDGEELVSGRSP
GPNVAVNAKGSVYIGGAPDVATLTGGRFSSGITGCVKNLVLHSARPGAPPPQPLDLQHRA
QAGANTRPCPS
Download sequence
Identical sequences ENSGGOP00000012925 ENSGGOP00000012925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]