SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012932 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012932
Domain Number 1 Region: 151-202,320-392
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000433
Family Calmodulin-like 0.04
Further Details:      
 
Domain Number 2 Region: 88-260
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000733
Family Calmodulin-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012932   Gene: ENSGGOG00000013255   Transcript: ENSGGOT00000013305
Sequence length 434
Comment pep:known_by_projection chromosome:gorGor3.1:13:3167679:3292589:-1 gene:ENSGGOG00000013255 transcript:ENSGGOT00000013305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVGSCARLAAWGGKLRRGLAVSRQAVRSPGPLAAAVAGAALAGAGAAWHHSCVNVAA
RDGSLTVSAQKNVEHGIIYIGKPSLRKQRFMQFSSLEHEGEYYMTPRDFLFSVMFEQMER
KTSVKKLTKKDIEDTLSGIQTAGCGSTFFRDLGDKGLISYTEYLFLLTILTKPHSGFHVA
FKMLDTDGNEMIEKREFFKLQKIISKQDDLMTVKTNETGYQEAIVKEPEINTTLQMRFFG
KRGQRKLHYKEFRRFMENLQTEIQEMEFLQFSKGLSFMRKEDFAEWLLFFTNTENKDIYW
KNVREKLSAGESISLDEFKSFCHFTTHLEDFAIAMQMFSLAHRPVRLAEFKRAVKVATGQ
ELSNNILDTVFKIFDLDGDECLSHEEFLGVLKNRMHRGLWVPQHQSIQEYWKCVKKESIK
GVKEVWKQAGKGLF
Download sequence
Identical sequences G3RBR8
ENSGGOP00000012932 XP_004054292.1.27298 ENSGGOP00000012932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]