SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012941 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012941
Domain Number 1 Region: 41-201
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.17e-43
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.00011
Further Details:      
 
Domain Number 2 Region: 202-332
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 8.5e-41
Family Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain 0.0000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012941   Gene: ENSGGOG00000013267   Transcript: ENSGGOT00000013315
Sequence length 336
Comment pep:known_by_projection chromosome:gorGor3.1:7:27780244:27923463:-1 gene:ENSGGOG00000013267 transcript:ENSGGOT00000013315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASLRLLGAASGLRYWSRRLRPAAGSFAAVCSRSVASKTPVGFIGLGNMGNPMAKNLMK
HGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSINAIEAYSGANGIL
KKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVED
EFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDPKLL
AKILNMSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPI
LLGSLAHQIYRMMCAKGYSKKDFSSVFQFLREEETF
Download sequence
Identical sequences A0A024RA75 G1RYC1 G3RBS7 H2R5F7 P31937
ENSGGOP00000012941 ENSP00000265395 ENSPTRP00000048098 ENSNLEP00000018248 400062 hsi002021624.1 ENSNLEP00000018248 gi|23308751|ref|NP_689953.1| ENSP00000265395 NP_689953.1.87134 NP_689953.1.92137 XP_003270508.1.23891 XP_003807946.1.60992 XP_004045277.1.27298 XP_016801048.1.37143 XP_519013.3.37143 ENSP00000265395 ENSPTRP00000048098 ENSGGOP00000012941 9606.ENSP00000265395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]