SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012977 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012977
Domain Number 1 Region: 199-342
Classification Level Classification E-value
Superfamily PH domain-like 6.76e-44
Family Third domain of FERM 0.000000323
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 1.7e-38
Family Second domain of FERM 0.000000602
Further Details:      
 
Domain Number 3 Region: 499-587
Classification Level Classification E-value
Superfamily Moesin tail domain 1.57e-31
Family Moesin tail domain 0.0000262
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.55e-26
Family First domain of FERM 0.00000601
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012977   Gene: ENSGGOG00000013301   Transcript: ENSGGOT00000013352
Sequence length 587
Comment pep:known_by_projection chromosome:gorGor3.1:6:159932114:159989119:-1 gene:ENSGGOG00000013301 transcript:ENSGGOT00000013352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLK
LDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPE
TAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHR
GMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERRQQLETEKKRRETVEREKEQMMREKEELMLRLQDYEEKTK
KAERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAA
ELAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYE
PVSYHVQESLQDEGTEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELS
QARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL
Download sequence
Identical sequences ENSGGOP00000012977 ENSGGOP00000012977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]