SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012988 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012988
Domain Number 1 Region: 31-57,174-353
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.15e-61
Family G proteins 0.0000000601
Further Details:      
 
Domain Number 2 Region: 61-181
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 2.35e-41
Family Transducin (alpha subunit), insertion domain 0.00000344
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012988   Gene: ENSGGOG00000013316   Transcript: ENSGGOT00000013363
Sequence length 354
Comment pep:known_by_projection chromosome:gorGor3.1:1:112488242:112499975:-1 gene:ENSGGOG00000013316 transcript:ENSGGOT00000013363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGASAEDKELAKRSKELEKKLQEDADREAKTVKLLLLGAGESGKSTIVKQMKIIHQDG
YSPEECLEFKAIIYGNVLQSILAIIRAMTTLGIDYAEPSCADDGRQLNNLADSIEEGTMP
PELVEVIRRLWKDGGVQACFERAAEYQLNDSASYYLNQLERITDPEYLPSEQDVLRSRVK
TTGIIETKFSVKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDDEV
NRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEEKIKKVHLSICFPEYDGNNSYDDAG
NYIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF
Download sequence
Identical sequences G3RBX2
XP_004026324.1.27298 ENSGGOP00000012988 ENSGGOP00000012988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]