SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012997 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012997
Domain Number 1 Region: 155-344
Classification Level Classification E-value
Superfamily E set domains 9.33e-65
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000194
Further Details:      
 
Domain Number 2 Region: 49-169
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.18e-18
Family Voltage-gated potassium channels 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012997   Gene: ENSGGOG00000013329   Transcript: ENSGGOT00000013372
Sequence length 375
Comment pep:known_by_projection chromosome:gorGor3.1:21:26760436:26807512:1 gene:ENSGGOG00000013329 transcript:ENSGGOT00000013372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAIHIGMSSTPLAKHTAGAGLKANRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVID
MKWRYKLTLFAATFVMTWFLFGVIYYAIAFIHGDLEPGEPISNHTPCIMKVDSLTGAFLF
SLESQTTIGYGVRSITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKF
SHCAVITKQNGKLCLVIQVANMRKSLLIQCQLSGKLLQTHVTKEGERILLNQATVKFHVD
SSSESPFLILPMTFYHVLDETSPLRDLTPENLKEKEFELVVLLNATVESTSAVCQSRTSY
IPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKYRQEDQ
RERELRTLLLQQSNV
Download sequence
Identical sequences A0A2I2Z4P9
ENSGGOP00000012997 ENSGGOP00000012997 XP_004062830.1.27298 XP_004062837.1.27298 XP_018873366.1.27298 XP_018873367.1.27298 XP_018873368.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]