SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013015 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013015
Domain Number 1 Region: 1057-1278
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 2.09e-81
Family Fibrinogen C-terminal domain-like 0.00000158
Further Details:      
 
Domain Number 2 Region: 710-873
Classification Level Classification E-value
Superfamily Fibronectin type III 2.76e-21
Family Fibronectin type III 0.00074
Further Details:      
 
Domain Number 3 Region: 444-605
Classification Level Classification E-value
Superfamily Fibronectin type III 4.27e-21
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 4 Region: 886-1047
Classification Level Classification E-value
Superfamily Fibronectin type III 2.79e-19
Family Fibronectin type III 0.00073
Further Details:      
 
Domain Number 5 Region: 619-706
Classification Level Classification E-value
Superfamily Fibronectin type III 2.54e-18
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 6 Region: 265-424
Classification Level Classification E-value
Superfamily Fibronectin type III 3.88e-17
Family Fibronectin type III 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000013015
Domain Number - Region: 237-260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00109
Family Integrin beta EGF-like domains 0.067
Further Details:      
 
Domain Number - Region: 174-199
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00446
Family Integrin beta EGF-like domains 0.049
Further Details:      
 
Domain Number - Region: 205-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0193
Family Integrin beta EGF-like domains 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013015   Gene: ENSGGOG00000013336   Transcript: ENSGGOT00000013391
Sequence length 1299
Comment pep:known_by_projection chromosome:gorGor3.1:1:154407133:154495064:1 gene:ENSGGOG00000013336 transcript:ENSGGOT00000013391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLQEMFRFPMGLLLGSVLLVASAPATLEPPGCSNKEQQVTVSHTYKIDVPKSALVQVDA
DPQPLSDDGASLLALGEAGEEQNIIFRHNIRLQTPQKDCELAGSVQDLLARVKKLEEEMV
EMKEQCSAQRCCQGVTDLSRHCSGHGTFSLETCSCHCEEGREGPACERLACPGACSGHGR
CVDGRCLCHEPYVGADCGYPACPENCSGHGECVRGVCQCHEDFMSEDCSEKRCPGDCSGH
GFCDTGECYCEEGFTGLDCAQVVTPQGLQLLKNTEDSLLVSWEPSSQVDHYLLSYYPLGK
ELSGKQIQVPKEQHSYEILSLLPGTKYIVTLRNVKKEVSSSPQHLLATTDLAVLGTAWVT
DETENSLDVEWENPSTEVDYYKLRYGPMTGQEVAEVTVPKSSDPKSRYDITGLHPGTEYK
ITVVPMRGELEGKPILLNGRTEIDSPTNVVTDRVTEDTATVSWDPVQAVIDKYVVRYTSA
DGDTKEMAVHKDESSTVLTGLKPGEAYKVYVWAERGNQGSKKADTNALTEIDSPANLVTD
RVTENTATISWDPVQATIDKYVVRYTSADDQETREVLVGKEQSSTVLTGLRPGVEYTVHV
WAQKGDRESKKADTNAPTDIDSPKNLVTDRVTENMATVSWDPVQAAIDKYVVRYTSAGGE
TREVPVGKEQSSTVLTGLRPGMEYMVHVWAQKGDQESKKADTKAQTDIDSPQNLVTDRVT
ENMATVSWDPVRATIDRYVVRYTSAKDGETREVPVGKEQSSTVLTGLRPGVEYTVHVWAQ
KGAQESKKADTKAQTDIDSPQNLVTDQVTENTATVSWDPVQATIDRYVVRYMSANGETRE
VPVGKEQSSTVLTGLRPGVEYTVHVWAQKGNQESKKADTKAQTEIDSPKNLVTDWVTENM
ATVSWDPVQATIDKYMVRYISADGETGEVPVGKEHSSTVLTGLRPGMEYMVHVWAQKGAQ
ESKKADTKAQTELDPPRNLRPSAVTQSGGVLTWTPPSAQIHGYILTYQFPDGTVKEMQLG
REDQRFELQGLEQGATYPVSLVAFKGGRRSRNVSTTLSTVGARFPHPSDCSQVQQNSNAA
SGLYTIYLHGDASRPLQVYCDMDTDGGGWIVFQRRNTGQLDFFKRWRSYVEGFGDPMKEF
WLGLDKLHNLTTGTPVRYEVRVDLQTANESAYAIYDFFQVASSKERYKLTVGKYRGTAGD
ALTYHNGWKFTTFDRDNDIALSNCALTHHGGWWYKNCHLANPNGRYGETKHSEGVNWEPW
KGHEFSIPYVELKIRPHGYSREPVLGRKKRTLRGRLRTF
Download sequence
Identical sequences G3RBZ8
ENSGGOP00000013015 XP_004027984.1.27298 ENSGGOP00000013015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]