SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013029 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013029
Domain Number 1 Region: 226-316
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 5.67e-29
Family SWIB/MDM2 domain 0.0000046
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000013029
Domain Number - Region: 352-405
Classification Level Classification E-value
Superfamily Virus ectodomain 0.0185
Family Virus ectodomain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013029   Gene: ENSGGOG00000013355   Transcript: ENSGGOT00000013405
Sequence length 456
Comment pep:known_by_projection chromosome:gorGor3.1:12:48035877:48055591:1 gene:ENSGGOG00000013355 transcript:ENSGGOT00000013405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPGMLPGSRMTPQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNR
NHNAKKKKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRLDIQEALKRPIKQK
RKLRIFISNTFNPAKSDAEDGEGTVASWELRVEGRLLEDSALSKYDATKQKRKFSSFFKS
LVIELDKDLYGPDNHLVEWHRTATTQETDGFQVKRPGDVNVRCTVLLMLDYQPPQFKLDP
RLARLLGIHTQTRPVIIQALWQYIKTHKLQDPHEREFVICDKYLQQIFESQRMKFSEIPQ
RLHALLMPPEPIIINHVISVDPNDQKKTACYDIDVEVDDTLKTQMNSFLLSTASQQEIAT
LDNKIHETIETINQLKTQREFMLSFARDPQGFINDWLQSQCRDLKTMTDVVGNPEEERRA
EFYFQPWAQEAVCRYFYSKVQQRRQELEQALGIRNT
Download sequence
Identical sequences D2HJC7 F6X8K1 G3RC11 G7N6Y4 G7PI99
ENSGGOP00000013029 ENSFCAP00000008775 ENSECAP00000019574 ENSGGOP00000013029 ENSECAP00000019574 9685.ENSFCAP00000008775 9796.ENSECAP00000019574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]