SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013038 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013038
Domain Number 1 Region: 139-323
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-57
Family SPRY domain 0.000001
Further Details:      
 
Domain Number 2 Region: 55-127
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000404
Family RING finger domain, C3HC4 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013038   Gene: ENSGGOG00000011393   Transcript: ENSGGOT00000013415
Sequence length 339
Comment pep:novel chromosome:gorGor3.1:22:16378132:16386368:-1 gene:ENSGGOG00000011393 transcript:ENSGGOT00000013415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLIRLEGVEGRDPLGGGNLTNKRPSCAPSPQDLSAQWKQLEDRGASSRRVDMAALFQEAS
SCPVCSDYPEKPMSLECGCAVCLKCINSLQKEPHGEDLLCCCCSMVSQRNKIRPNRQLER
LASHIKELEPKLKKILQMNPRMRKFQVDMTLDADTANNFLLISDDLGSVRSGLITQNRQH
LAERFDVSVCVLGSPRFTCGRHYWEVDVGTSTEWDLGVCRESVHRKGKIQLTTELGFWTV
SLRDGGRLSASTVPLTFLFVDRKLQRVGIFLDMGMQNVSFFDAKSGSHVYTFRSVSAEEP
LRPFLAPSIPPNGDQGVLSICPLMNSGTTDAPVRPGEAK
Download sequence
Identical sequences ENSGGOP00000013038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]