SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013052 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013052
Domain Number 1 Region: 117-352
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.35e-42
Family Voltage-gated potassium channels 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013052   Gene: ENSGGOG00000013377   Transcript: ENSGGOT00000013429
Sequence length 676
Comment pep:known_by_projection chromosome:gorGor3.1:11:2403929:2804717:1 gene:ENSGGOG00000013377 transcript:ENSGGOT00000013429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAASSPPRAERKRWGWGRLPGARRGSAGLAKKCPFSLELAEGGPAGGALYAPIVPGAPG
PAPPASPAAPAAPPVASDLGPRPPVSLDPRVSIYSTRRPLLARTHVQGRVYNFLERPTGW
KCFVYHFAVFLIVLVCLIFSVLSTIEQYAALATGTLFWMEIVLVVFFGTEYVVRLWSAGC
RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLH
VDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVNESGRVEFGSYA
DALWWGVVTVTTIGYGDKVPQTWVGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQR
QKHFNRQIPAAASLIQTAWRCYAAENPDSSTWKIYIRKPPRSHTLLSPSPKPKKSVVVKK
KKFKLDKDNGVTPGEKMLTVPHITCDPPEERRLDHFSVDGYDSSVRKSPTLLEVSMPHFM
RTNSFAEDLDLEGETLLTPITHISQLREHHRATIKVIRRMQYFVAKKKFQQARKPYDVRD
VIEQYSQGHLNLMVRIKELQRRLDQSIGKPSLFISVSEKSKDRGSNTIGARLNRVEDKVT
QLDQRLALITDMLHQLLSLHGGSTPGSGSPPREGGAHITQPCSSGGSVDPELFLPSNTLP
TYEQLTVPRRGPDEGS
Download sequence
Identical sequences G3RC31
ENSGGOP00000013052 XP_004050493.1.27298 ENSGGOP00000013052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]