SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013054 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013054
Domain Number 1 Region: 94-173
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.000000000384
Family HSP20 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013054   Gene: ENSGGOG00000013385   Transcript: ENSGGOT00000013431
Sequence length 196
Comment pep:known_by_projection chromosome:gorGor3.1:12:118976074:118992018:1 gene:ENSGGOG00000013385 transcript:ENSGGOT00000013431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAW
PGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVE
VSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGES
SFNNELPQDSQEVTCT
Download sequence
Identical sequences A0A096N1G3 A0A0D9S4F0 A0A2J8XK94 A0A2K5ICT1 A0A2K5MN58 A0A2K5UDI9 A0A2K5Y3M8 A0A2K6DY64 A0A2K6KAJ7 A0A2K6NTK0 F7HTN7 G1QH72 G3RC33 H2Q6Z7 Q5RAB0 Q9UJY1
gi|7657146|ref|NP_055180.1| ENSPTRP00000009367 ENSNLEP00000000259 ENSMMUP00000027956 9544.ENSMMUP00000027956 9598.ENSPTRP00000009367 9600.ENSPPYP00000005717 9606.ENSP00000281938 ENSMMUP00000027956 ENSGGOP00000013054 ENSP00000281938 GO.35258 HR6378 hsi002005257.1 ENSGGOP00000013054 ENSP00000281938 ENSPTRP00000009367 ENSPANP00000006135 ENSP00000281938 NP_001127400.1.23681 NP_055180.1.87134 NP_055180.1.92137 XP_003280015.1.23891 XP_003832453.1.60992 XP_004054027.1.27298 XP_005572431.1.63531 XP_008003085.1.81039 XP_010366573.1.97406 XP_011762381.1.29376 XP_011784109.1.43180 XP_011819798.1.47321 XP_011930486.1.92194 XP_017734568.1.44346 XP_509417.1.37143 ENSNLEP00000000259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]